Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c106 Olfactory Receptor

Gene Symbol Or4c106
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88851952-88852878 (+)
Aliases Olfr1204, RP23-350F2.5, MOR232-6, RP23-350F2.5, MOR232-6

Sequence information


Nucleotide sequence

ATGGAAATTAAGAACAACGTGACAGAGTTTGTTCTCCTGGGGCTCACACAGAATCCGCAG
TTGCAGAAAATCTTGTTTGTTGTGTTTTTGGTTATCTATGTTTTCTCTGTGGCAGGAAAT
TTGCTCATTCTAATCACCATTACAAACAGCCAACTGTTGGGGTACCCTATGTATTACTTC
CTGGCCTATCTCTCTTTTATTGATGCTTGCTACTCCTCTGTCAATACACCTAAACTGCTT
GCTGATACTTTCCATAAAAGGAAATCTATTAAATTCAATGGATGCATGACCCAAGTTTTT
GCAGAACATTTCATTGGAGGAACTGAAGTCATCTTGCTTACTGTGATGGCTTATGACCGC
TATGTAGCCATCTGTAAACCCCTGCACTATGCAACCATCATGAACAGACGACTCTGTAAC
ATCCTAGTGGGAGTGTCATGGGTTGGAGGCTTTCTTCATGGAGGTATACAAATTCTTTTC
ATTATTGAATTACCTTTCTGTGGCCCTAATGTCATAGACCACTTTATGTGTGATCTTAAC
CCTTTGCTTGATCTAGCCTGTATTGACACCCACATCCTGGGGCTTTTTGTTGCTGCCAAT
AGTGGTTTCATTTGTCTGTTAAATTTCCTCTTACTGCTTGTGTCCTACTTGGTCATCCTT
AACTCCCTAAGGACCCACAGTGCAGAAGGCAGGCGCAAAGCCCTCTCTACCTGTGTTTCT
CACATTACAGTAGTGGTTTTATTTTTTGTGCCCTGCATATTTGTGTACATGAGACCTGCA
GCTACATTACCCATTGATAAAGCAGTCGCTTTGTTTTATACTATGATAACCCCTATGTTG
AATCCATTAATCTATACCTTAAGAAATGCTCAGATGAAAAATGCCATTTGGAAATTGTTT
AGTGTAAAAGTTCAGTCAGATGACAAA


Conceptual translation

MEIKNNVTEFVLLGLTQNPQLQKILFVVFLVIYVFSVAGNLLILITITNSQLLGYPMYYF
LAYLSFIDACYSSVNTPKLLADTFHKRKSIKFNGCMTQVFAEHFIGGTEVILLTVMAYDR
YVAICKPLHYATIMNRRLCNILVGVSWVGGFLHGGIQILFIIELPFCGPNVIDHFMCDLN
PLLDLACIDTHILGLFVAANSGFICLLNFLLLLVSYLVILNSLRTHSAEGRRKALSTCVS
HITVVVLFFVPCIFVYMRPAATLPIDKAVALFYTMITPMLNPLIYTLRNAQMKNAIWKLF
SVKVQSDDK