Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c107b-ps Olfactory Receptor

Gene Symbol Or4c107b-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:77653468-77654298 (+)
Aliases Olr667-ps, Olr667-ps

Sequence information


Nucleotide sequence

ACAAACACATATATCAGAAAGAACACAAAGTACTCCCATACAAACATAAATGACTAAATA
CCTATAAATTAAAAAAATTGTTAAAGTTGACTTGACAGTCATGCCAAACCAAACTATTGT
AACTGAGTTCATCCTCCTGGGACTTTCAGAGAATCCAAAAGTTCAGAAAATACTATTTAT
TGTATTTTCTTTTGTCTACATGGCAACAATTGGAGGCAGCATTATCATTGCAGTGACCAT
ACTCTGCACCCCTGCACTACTTGGATCACCCATATACTTCTTCTTGGCATTTCTGTCCTT
CCTGGATGCATGCATTACTTCAGTCATCACACAAAAAAGGATTGTTGACTCAATCAACGA
CAGCAAAACAATTTCTTTTGAAGGCTGCATGACACAGATCTTTGCTGAACATTTCTTTGC
TGCCGTGGAAGTGATTGTCCTAATATCCATGGCCTATGACCGCTATGTGGCCATTTGCAA
GCCATTACACTACTCTTCCATAATGAACTGGAAGCTCTGTGGCACTCTGGTAGGGATAGC
AAGGGCTGGGGGATGCTGACAGTCTATCATACAAATTATCTTCACTTTGCAGCTACCATT
TTGTGGACCCAATGTCATTGATCACTTCATGTGTGACTTGTTTCCAATTACTGGAGTTGG
CATGCACTAACACTTATGTTTATGGCCTCTTAGTGTTTGCCAACAGTGGGTCTATCTGCA
ACATAAATCTTTTTTTTTAAATTAACTTGAGTATTTCTTATATACATTTCGAGTGTTATT
CCCTTTCCCGGTTTCCGGGTAAACATCCCCCTCCCCCCTCCCCTTCTTTAT


Conceptual translation

MPNQTIVTEFILLGLSENPKVQKILFIVFSFVYMATIGGSIIIAVTILCTPALLGSPIYF
FLAFLSFLDACITSVITQKRIVDSINDSKTISFEGCMTQIFAEHFFAAVEVIVLISMAYD
RYVAICKPLHYSSIMNWKLCGTLVGIARAGGC*QSIIQIIFTLQLPFCGPNVIDHFMCDL
FP\LELACTNTYVYGLLVFANSGSICNINLFF