Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c108b-ps Olfactory Receptor

Gene Symbol Or4c108b-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:77,660,900-77,661,600 (-)
Aliases Olr668

Sequence information


Nucleotide sequence

AGAACCATTTCTTTTGATGGTTGCATGGCACAAGTCTTTGCTGTGCACTTCTTTACTGGA
GTAGAGGTTATTATCCTGATAACCATGGCCTATGACCGTTATGTGGCCATCTGCAAGCCC
TTGCTCTATTCTTCCATTATGAACAGGAGACTCTGTGCAATTCTGGTGGGGATAGCCTGG
ACAGGGGGCTTCTTGCATTCTATCATACAAATTATCTTCATTTTATATCTGCCTTTTTGT
GGCCCAAATGTCATTGATCACTTCTTGTGTGACTTGTTCCCATTACTAAAGCTTGCCTGC
ACTGACACACATATTTTTGTCATTTTGGTGTTTGCCAACAGTGGCTCTATCTGCATCATC
ATCTTTTCCTTGTTGCTTGTTTCCTATGGTGTCATCTTGTTCTCTTTGAGAGCCCACAGT
TCTGAAGGAAGACATAAAGCGCTCTCTACCTGCGGATCCCACATTACTGTGGTGGTTTTG
TTCTTTGTGCCGTGCATATTAATATATGCAAGACCTGCATCTGCCTTCTTCTCTGAAAAA
AATGTGTTTTTATTTGCTACCATCCTGACACCATTGCTAAATCCTATGATTTACACTTTC
AGGAATAAGGAAATGAAGAATGCCATAAGGAAAATGTGGAAGAGATTGATATTGGATTAT
GGTTTATCT


Conceptual translation

MQNQSFVTEFLLLGLSQNPKVHKIIFIAFLFVYIATFGGNMIIVVTIINSHALLGSPM\
TISFDGCMAQVFAVHFFTGVEVIILITMAYDRYVAICKPLLYSSIMNRRLCAILVGIAWT
GGFLHSIIQIIFILYLPFCGPNVIDHFLCDLFPLLKLACTDTHIFVILVFANSGSICIII
FSLLLVSYGVILFSLRAHSSEGRHKALSTCGSHITVVVLFFVPCILIYARPASAFFSEKN
VFLFATILTPLLNPMIYTFRNKEMKNAIRKMWKRLILDYGLS