Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c109 Olfactory Receptor

Gene Symbol Or4c109
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88987268-88988200 (-)
Aliases Olfr1214, RP23-260B13.8, MOR233-8, RP23-260B13.8, MOR233-8

Sequence information


Nucleotide sequence

ATGCATAACCAGAGCTATGTCAATGAGTTCATACTCCTGGGACTTTCACAAAACCCACAA
ATTGTGAAAATATCATTTGTTATATTTTTATTGGTTTACCTTGCAACTCTTGTGGGCAAC
ATGATAATTGTGGTGACCATTGTCTACAGTCCTGCACTACTGGGCTCCCCCATGTACTTC
TTCTTGGCATTCCTGTCCTTCCTGGATGCTTGTGTCTCCTCTGTTGTCACACCTAAGATG
ATTGTGGACATGACTTATGAGAGGAAGATTATCTCTTTTGAATGTTGTATGACACAGGTC
TTTGCTGTGCACTTTCTTACTGCTGTAGAGGTCATTGTCCTCGCAGCCATGGCCTATGAC
CGCTATGTGGCTATTTGCAAGCCCTTGCACTACTCTTTCATCATGAATCGGAGGCTCTGT
GGCACTCTGGTTGGGGTAGCCTGGGCTGGAGGATTCTTGCATTCTATCATACAAATTGCC
TTTATTTTAAAATTGCCCTTCTGTGGACCCAATGTTATTGATCATTTCATATGTGACTTG
TTTCCATTGCTGAAGCTTGCCTGCACTGATATACACATTTTTATCATTTTGGTGTTTGCT
AACAGTGGGTCTATCTGCATAATTATATTCTCCTTTTTGCTCATTTCCTATGGTGTTATA
TTGTTCTCTCTGAGAGCCCACAGCTCAGAAGGGCGCCGTAAGGCTCTTTCTACCTGTGGA
TCCCATATTACTGTTGTAGTTTTTTTCTTTGTTTCCTGTATATTAATATATGCACGGCCC
ACATCTGCATTTTCCTTTGAGAAAAATGTTTTTGTGTTTACAGATGTCTTGACACCACTG
CTTAATCCTATGGTTTACACTTTCAGGAATAAGGAAATGATAAATGCCATCAGGAAAATG
AGGAAGAGACTTATAATGGTTCCTGATAAATAT


Conceptual translation

MHNQSYVNEFILLGLSQNPQIVKISFVIFLLVYLATLVGNMIIVVTIVYSPALLGSPMYF
FLAFLSFLDACVSSVVTPKMIVDMTYERKIISFECCMTQVFAVHFLTAVEVIVLAAMAYD
RYVAICKPLHYSFIMNRRLCGTLVGVAWAGGFLHSIIQIAFILKLPFCGPNVIDHFICDL
FPLLKLACTDIHIFIILVFANSGSICIIIFSFLLISYGVILFSLRAHSSEGRRKALSTCG
SHITVVVFFFVSCILIYARPTSAFSFEKNVFVFTDVLTPLLNPMVYTFRNKEMINAIRKM
RKRLIMVPDKY