Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c109b Olfactory Receptor

Gene Symbol Or4c109b
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:77617586-77618518 (-)
Aliases Olr666, Olr666

Sequence information


Nucleotide sequence

ATGCATAATCAGAGCTTTGTCAATGAATTCATACTCCTGGGATTTTCACAAAACCCCCAA
ATTAAGAAAATATCATTTGTTATATTTTTATTGGTCTATATTGCAACTCTTGTGGGTAAC
ATGATGATTGTGGTGACCATCGTCTACAGCCCTGCCCTTCTGGGCTCACCCATGTACTTC
TTCTTGGCATTCCTGTCCTTCTTGGATGCTTGTGTCTCCTCTGTTGTCACACCAAAGATG
ATCGTGGACATGGTTTACGAAAGGAAAAGCATCTCTTTTGAATGTTGTATGACACAGGTC
TTTGCTGTGCACTTTCTTAGTGCGGTGGAGGTCACTGTCCTGGCAGCCATGGCCTATGAC
CGCTATGTGGCCATTTGCAAGCCGTTACACTACTCTTTCATCATGAATCGGAGGCTCTGT
GGCAGTCTGGTGGGGGTAGCCTGGGCTGGAGGATTCTTGCATTCTATCATACAAATTGCC
TTTACTTTGCAATTGCCCTTCTGTGGACCCAATGTCATCGATCATTTCATATGTGACTTG
TTTCCATTGTTGAAGCTTGCCTGCACTGACATACACATTTTTATCATTTTGGTGTTTGCC
AACAGTGGGTCTTTCTGCATAATTATATTCTCATTTTTGCTCATTTCCTATGGTGTTATA
TTGTTCTCTCTGAGAGCCCACAGCTCTGAAGGGCGCCGTAAGGCTCTCTCTACCTGTGGA
TCCCATATTACAGTTGTAGTTTTGTTCTTCGTTCCTTGTATATTAATATATGCACGGCCC
ACATCTGCATTTTCTTTTGAGAAAAATGTTTTTGTGTTTATAGATGTTCTGACACCACTG
CTTAATCCTATGGTTTACACTTTCAGGAATAAGGAAATGATAAATGCCATCAGGAAAATG
TGGAAGAGGCTAATAGTTGTTTCTGATAAATAT


Conceptual translation

MHNQSFVNEFILLGFSQNPQIKKISFVIFLLVYIATLVGNMMIVVTIVYSPALLGSPMYF
FLAFLSFLDACVSSVVTPKMIVDMVYERKSISFECCMTQVFAVHFLSAVEVTVLAAMAYD
RYVAICKPLHYSFIMNRRLCGSLVGVAWAGGFLHSIIQIAFTLQLPFCGPNVIDHFICDL
FPLLKLACTDIHIFIILVFANSGSFCIIIFSFLLISYGVILFSLRAHSSEGRRKALSTCG
SHITVVVLFFVPCILIYARPTSAFSFEKNVFVFIDVLTPLLNPMVYTFRNKEMINAIRKM
WKRLIVVSDKY