Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c10b Olfactory Receptor

Gene Symbol Or4c10b
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89880828-89881754 (+)
Aliases Olfr1257, RP24-166A20.1, MOR232-1, RP24-166A20.1, MOR232-1

Sequence information


Nucleotide sequence

ATGGAGAACCAAAACAATGTGACAGAATTTATCCTTCTGGGACTCACAGAGAACCCAAAG
ATGCAAAAAATTGTATTCATTATGTTTTTTCTTATCTACATCATTTCTATAACAGGAAAT
GTGCTCATTGTGGTCACCATAACTTCTACGTCATTATTAGAGTCCCCCATGTACTTTTTC
CTGGCTTATCTATCCTTTATTGATGCTTGCTATTCCTCTGTTAGCACCCCTAAACTGATA
GCAGATTCACTCTGTGAAAAGAAGACCATCCCATTTAATGGATGCATGACTCAGATCTTT
GGGGAGCATTTGTTTGGAGGTGCTGAAATCATCCTGCTGACAGTAATGGCCTATGACCGC
TATGTGGCCATCTGCAAACCCCTTCATTATGCAACGATCATGAGTCGAAGACTATGTAGC
CTGCTAGTGGGAGTGTCATGGCTAGGAGGTTTTCTTCATGCCACCATACAGATCCTGTTC
ATTTTCCAATTACCCTTCTGTGGCCCTAACATCATAGATCATTTTATGTGTGATCTTAAT
CCTTTGCTCAACCTTGTATGCACCGATACTCACACTCTTGGAATCTTTGTTGCAGCCAAC
AGTGGTTTTATTTGTCTGCTAAACTTCCTTCTTCTATTGGTCTCCTATGTTGCCATCCTG
CGCTCCCTAAAGAACCACAGTGCAGAGGGAAGGCGCAAAGCCCTCTCTACCTGTATTTCA
CACATAACAGTGGTTGTCTTATTCTTTGTGCCTTGCATATTTGTATACATGAGACCTGTA
GCTACCTTACCCATTGATAAAGCAGTTGCTATGTTCTATACTATGATAACTCCCATGTTG
AACCCCTTAATCTATACCTTAAGAAATGCTCAGATGAAAGATGCCATTAAGAAATTGGGT
AGCACTAAAATTCTTTCAAGTAATAAA


Conceptual translation

MENQNNVTEFILLGLTENPKMQKIVFIMFFLIYIISITGNVLIVVTITSTSLLESPMYFF
LAYLSFIDACYSSVSTPKLIADSLCEKKTIPFNGCMTQIFGEHLFGGAEIILLTVMAYDR
YVAICKPLHYATIMSRRLCSLLVGVSWLGGFLHATIQILFIFQLPFCGPNIIDHFMCDLN
PLLNLVCTDTHTLGIFVAANSGFICLLNFLLLLVSYVAILRSLKNHSAEGRRKALSTCIS
HITVVVLFFVPCIFVYMRPVATLPIDKAVAMFYTMITPMLNPLIYTLRNAQMKDAIKKLG
STKILSSNK