Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c10b Olfactory Receptor

Gene Symbol Or4c10b
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:78,748,000-78,748,900 (+)
Aliases Olr722

Sequence information


Conceptual translation

MENQNNVTEFILLGLTENPKMQKIVFIVFLLIYIISITGNVLIVVTIISTSLLQSPMYFF
LAYLSFIDACYSSVSTPKLITDSLCEKKTILFNSCMTQIFGEHLFGGAEIILLTVMAYDR
YVAICKPLHYATIMSRRLCSLLVGVSWLGGFLHATIQILFIFQLPFCGPNVIDHFMCDLN
PLLNLVCTDTHTLGLFVAANSGFICLLNFLLLLVSYVAILRSLKNHSAEGRRKALSTCIS
HITVVVLFFVPCIFVYMRPVATLPIDKAVAMFYTMITPMLNPLIYTLRNAQMKDAIKKLG
STKILSSNK