Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c111 Olfactory Receptor

Gene Symbol Or4c111
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89,013,100-89,014,100 (-)
Aliases Olfr1216

Sequence information


Nucleotide sequence

MQNQSSVTEFIILGLSQNPKIEKILFVVFLLVYMATVGGNMIIVVTIIYSPALLSSPMYF
FLAFLSFLDACVSSTVTPKMVVDFLHEKKTISFGCCMTQLFSVHFFSGAEMIVLAAMAYD
RYVAICKPLHYSSILTRRLCSILVAISWAGGFLHAIVQVIFTLQLPLCGPNVIDHYMCDL
FPLLKLACTDTHIFVLLVFANSGAICIIIFSLLLVSYGVILFSLRAHSSEGRRKALSTCG
AHVTVVVLFLVPCILIYARDTSAFSYEKDTLIFVNVLTPLLNPMVYTFRNKEMINAIRKM
WKRLIVIFVRY


Conceptual translation

MQNQSSVTEFIILGLSQNPKIEKILFVVFLLVYMATVGGNMIIVVTIIYSPALLSSPMYF
FLAFLSFLDACVSSTVTPKMVVDFLHEKKTISFGCCMTQLFSVHFFSGAEMIVLAAMAYD
RYVAICKPLHYSSILTRRLCSILVAISWAGGFLHAIVQVIFTLQLPLCGPNVIDHYMCDL
FPLLKLACTDTHIFVLLVFANSGAICIIIFSLLLVSYGVILFSLRAHSSEGRRKALSTCG
AHVTVVVLFLVPCILIYARDTSAFSYEKDTLIFVNVLTPLLNPMVYTFRNKEMINAIRKM
WKRLIVIFVRY