Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c112 Olfactory Receptor

Gene Symbol Or4c112
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89023090-89024001 (-)
Aliases Olfr1217, RP23-260B13.11, MOR233-4, RP23-260B13.11, MOR233-4

Sequence information


Nucleotide sequence

ATGCAAAACCAGAGCTTTGTCACTGAGTTCATACTCCTGGGACTTTCACAGAACCTGAAT
GTGGAGAAAATGCTATTTGTTTTATTTTTGTTTATCTACATTGCAACTATTGGGGGCAAC
ATGATGATTGTGGTGACCATCATCTACAGCCCTGCACTGCTGGGCTCCCCCATGTACTTC
TTCTTGGCATTCCTGTCCTTCCTGGATGCATGCACTTCTTCTACTGTCACACCCAAGATA
ATTGTAGACTGCTTCTATGAAAGGAAGACCATCTCCTTTGAATGTTGCATGACACAACTG
TTTACAGTCCACTTCTTCACTGGGGCAGAAGTGATTGTCTTGGCATCCATGGCCTATGAC
CGCTATGTGGCCATTTGCAAGCCTCTTCACTACTCTTCCATCATGACCCAGAGGCTCTGT
GGAATTTTAGTTGTGGTATCTTGGGCAGGAGGTTTCTTGCATTCTATCATACAAATCATC
TTCACTTTGCAGCTGCCTTTATGTGGACCCAATGTCATTGATCATTACATGTGTGACTTG
TTCCCATTACTGAAGCTTGCCTGCACAGACACACACATTTATGTCCTTTTGATATTTGCC
AACAGTGGTGCTATATGCATTATAATCTTCTCCTTATTGATTGTCTCCTATGGTGTCATC
TTGTTTTCTCTGAGAGCCCAGAGTTCTGAAGGGCGACGTAAAGCTCTCTCCACCTGTGGG
TCCCATATAACTGTTGTACTTTTGTTTTTTGTCCCATGCATATTAATATATGCAAGACCT
ACTTCTGCATTCTCCTTTGAGAAAAATATGCTTATATTTGTCAATGTCCTGACACCACTG
CTCAATCCTATGGTTTACACTTTCAGGAATAAGGAAATGATAAATGCAATCAAGAAAATA
TGGAAAAGATTT


Conceptual translation

MQNQSFVTEFILLGLSQNLNVEKMLFVLFLFIYIATIGGNMMIVVTIIYSPALLGSPMYF
FLAFLSFLDACTSSTVTPKIIVDCFYERKTISFECCMTQLFTVHFFTGAEVIVLASMAYD
RYVAICKPLHYSSIMTQRLCGILVVVSWAGGFLHSIIQIIFTLQLPLCGPNVIDHYMCDL
FPLLKLACTDTHIYVLLIFANSGAICIIIFSLLIVSYGVILFSLRAQSSEGRRKALSTCG
SHITVVLLFFVPCILIYARPTSAFSFEKNMLIFVNVLTPLLNPMVYTFRNKEMINAIKKI
WKRF