Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c112b Olfactory Receptor

Gene Symbol Or4c112b
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:77825574-77826506 (-)
Aliases Olr675, Olr675

Sequence information


Nucleotide sequence

ATGCAAAACCATAGCTTTGTCACTGAGTTCATACTTCTTGGGCTCTCACAGAACCTGAAT
GTCGAGAAAATGCTATTATGTTTGTTGTTATTTATCTATTTTGCAACTATTGCGGGCAAC
ATGGTAATTGTGGTGACCATCATGTACAGTCCAGCACTGCTGGGCTCCCCCATGTACTTC
TTTTTGATATTCCTGTCATTACTCGATGCTTGCACTTCTTCTAGTGTCATCCCCAAGATA
ATTATAGACTGCTTCTCTGAGAGGAAGACCATCTCCTTTGAATGTTGTATGATACAACTG
TTTGCTGTCCACTTCTTCACTGGGGCAGAAGTCATTGTCCTGTCAGCCATGGCCTATGAC
CGCTATGTGGCCATCTGCAAGCCACTTCACTACTCTTCCATCATGACCCAGAGGCTCTGT
GGAATTTTGGTGGTTGTGTCCTGGGCAGGGGGATTCTTGCATTCTATCATACAGGTTATC
TTCACTTTGCAGCTGCCTTTCTGTGGACCCAATGTGATTGATCATTACATGTGTGACTTG
TTCCCATTACTGAAGCTTGCCTGCACTGACACACACATTTATATCTTTATGATATTTGCC
AACAGTGGTGCTATATGCATTATAATCTTCTCTTTATTGCTTGTCTCCTATGGTGTCATT
TTGTTTTCTCTGAGAACCCACAGCTCTGAAGGTCGATGTAAAGCTCTCTCTACCTGTGGA
TCCCATATCATTGTCGTGCTTTTGTTTTTTGTTCCATGCATATTAATATATGCAAGACCC
ACTTCTGCATTCTCCTTTGAGAAAAACGTGGTTACGTTTATGAATGCTGTTACACCATTG
ATAAATCCTATGGTTTACACTTTCAGGAATAAGGAAATGAAGAATGCCATCAGAAAAATG
TGGAAAAGATTAATAGTCATTTCTGATGAATTT


Conceptual translation

MQNHSFVTEFILLGLSQNLNVEKMLLCLLLFIYFATIAGNMVIVVTIMYSPALLGSPMYF
FLIFLSLLDACTSSSVIPKIIIDCFSERKTISFECCMIQLFAVHFFTGAEVIVLSAMAYD
RYVAICKPLHYSSIMTQRLCGILVVVSWAGGFLHSIIQVIFTLQLPFCGPNVIDHYMCDL
FPLLKLACTDTHIYIFMIFANSGAICIIIFSLLLVSYGVILFSLRTHSSEGRCKALSTCG
SHIIVVLLFFVPCILIYARPTSAFSFEKNVVTFMNAVTPLINPMVYTFRNKEMKNAIRKM
WKRLIVISDEF