Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c114 Olfactory Receptor

Gene Symbol Or4c114
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89074157-89075089 (-)
Aliases Olfr1219, RP23-309M6.1, MOR233-6, RP23-309M6.1, MOR233-6

Sequence information


Nucleotide sequence

ATGCAAAACCAGAGCTTTGTCACTGAGTTCATACTCCTGGGACTTTCACAGAACCTGTAT
GTGGAGAAAATACTATTTGTTTTATTTTTGCTGATCTACCTTGCAACTATTGGGGGCAAC
ATGATTATTGTGGTGACCATCATCTACAGCCCTGCACTGCTGGGCTCCCCCATGTACTTC
TTCTTGATATTCCTGTCCTTACTGGATGCATTAACTTCTTCTACTGTCACCCCAAAGATA
ATTGTAGACTGCTTCTATGAAAGGAAGACCATCTCCTTTGAATGTTGCATGACACAACTG
TTTACAGTCCACTTCTTCACTGGGGCAGAAGTGATTGTCTTGGCATCCATGGCCTATGAC
CGCTATGTGGCCATTTGCAAACCCCTTCACTACTCTTCCATCATGACTCGGAGGCTCTGT
GGAATTTTGGTAGTGGTGTCTTGGGCAGGAGGCTTCTTGCATTCTATCATACAAATCATC
TTCACATTGCAGCTGCCTTTCTGTGGCCCCAATGTCATTGATCATTACATGTGTGACTTG
TTCCCATTACTGAAGCTTGCCTGCACAGACACACACATTTATGTCCTTTTGATATTTGCC
AACAGTGGTGCTATATGCATTATAATCTTCTCCTTATTGCTTGTCTCTTATGGTATCATC
TTGTTCTCTCTGAGAGCCCACAGTTCTGAAGGTCGGCGTAAAGCTCTCTCCACCTGTGGG
TCCCATATAATTGTTGTGCTTTTGTGCTTTGTCCCATGCCTATTAATATATGCAAGACCT
ACTTCTGCATTCTCCTTTGAGAAAAACATGCTTATATTTATCAATGTCCTTACACCATTG
CTAAATCCTATGGTTTACACTTTCAGGAATAAGGAAATGAAGAATGCTATCGGAAAAATG
TGGAAGAGATTAATAGTGGTTTCTGATAAATTT


Conceptual translation

MQNQSFVTEFILLGLSQNLYVEKILFVLFLLIYLATIGGNMIIVVTIIYSPALLGSPMYF
FLIFLSLLDALTSSTVTPKIIVDCFYERKTISFECCMTQLFTVHFFTGAEVIVLASMAYD
RYVAICKPLHYSSIMTRRLCGILVVVSWAGGFLHSIIQIIFTLQLPFCGPNVIDHYMCDL
FPLLKLACTDTHIYVLLIFANSGAICIIIFSLLLVSYGIILFSLRAHSSEGRRKALSTCG
SHIIVVLLCFVPCLLIYARPTSAFSFEKNMLIFINVLTPLLNPMVYTFRNKEMKNAIGKM
WKRLIVVSDKF