Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c114b-ps Olfactory Receptor

Gene Symbol Or4c114b-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:77,846,800-77,848,000 (-)
Aliases Olr676-ps

Sequence information


Conceptual translation

MQNQSFVTEFILLGLSQNLNVEKMLLVLFLFIYFPTIGGNMIIVVTIIYSPALLGSPMYF
FLAFLSLLDASTSSTVTPKIIIDCFSERKTISFECCMIQLFAVHFFTGAEVIVLSSMAYD
RYVAICKPLHYSSIMTQKLCGILVVVSWTGGFLHSIIQIIFSLQLPFCGPNVIDHYMCDL
FPLLKLACTDTHIYVFMIFANSGAICIIIFSLLLVSYGVILFSLRAHSSEGRRKALSTCG
PHIIVLLFFVPCLVIYARPILHFP/EKNMLIFMNVLTPLINPMVYTFRTKEMKNAIRKM
WKRII