Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c115 Olfactory Receptor

Gene Symbol Or4c115
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89096993-89097925 (-)
Aliases Olfr1220, RP23-309M6.2, MOR233-5, RP23-309M6.2, MOR233-5

Sequence information


Nucleotide sequence

ATGGAAAACCAGAGCATTGTCAATGAGTTCATACTCTTGGGGCTTTCTCAGAATCCCAAA
ATTGAGAATATACTCTTTGTGGTATTTCTGTTGGTATACCTAGCAACAATCGGAGGCAAC
ATGATGATTATAGCAACCATCATCTACAGCCCTGCATTGCTGGGTTCTCCCATGTACTTC
TTCTTGATATTCCTGTCCTTATTGGATACTTGCACTTCTACTGTTGTCACACCCAAGCTT
ATTTTAGATTTCTTCTATGAGAGGAAGACCATCTCCTTTGAAGGCTGCATGACACAACTG
TTTGCTTTTCACTTCTTCACTGGTGCAGAGGTCATTGTCTTGGCAGCCATGGCCTATGAC
CGGTATGTGGCCATTTGCAAACCCCTTCACTACTCCTCCATCATGACCTGGAGAGTCTGT
GGTGTTTTGTTGGGGGTAGCCTGGACAGGGGGATTCTTACATTCTATTATACAAATTATC
TTTACTTTGCAGCTACCGTTCTGTGGACCCAATGTTATTGATAACTATATTTGTGACTTA
TTCCCATTACTCAAGCTTGCTTGCACTGATACACACATTTTTGTCTTTTTGGTCTTTGCA
AATAGTGGCTCTATCTGCATCATTATTTTCTCCTTACTGCTTGTCTCCTATGGTGTCATC
TTGTTCTCTCTGAGAGGCCATAGTTCCGAAGGACGACTTAAAGCTCTTTCCACCTGTGGA
TCCCATATTACAGTTGTTGTTTTGTTCTTTGTCCCATGTATATTAATATATGCACGAACT
ACATCACCATTCCCATATGAGAAATATGTGGCTATATTTGTCAATGTCATAACACCACTG
CTCAATCCTATGGTTTACACTTTCAGGAATAAGGAAATGAAGAATGCCATCCAAAAAATG
TGCAGAAGATCTAAAGTGGTTTCTGATAACTAT


Conceptual translation

MENQSIVNEFILLGLSQNPKIENILFVVFLLVYLATIGGNMMIIATIIYSPALLGSPMYF
FLIFLSLLDTCTSTVVTPKLILDFFYERKTISFEGCMTQLFAFHFFTGAEVIVLAAMAYD
RYVAICKPLHYSSIMTWRVCGVLLGVAWTGGFLHSIIQIIFTLQLPFCGPNVIDNYICDL
FPLLKLACTDTHIFVFLVFANSGSICIIIFSLLLVSYGVILFSLRGHSSEGRLKALSTCG
SHITVVVLFFVPCILIYARTTSPFPYEKYVAIFVNVITPLLNPMVYTFRNKEMKNAIQKM
CRRSKVVSDNY