Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c11b Olfactory Receptor

Gene Symbol Or4c11b
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88794384-88795304 (+)
Aliases Olfr1201, RP23-350F2.2, MOR230-2, RP23-350F2.2, MOR230-2

Sequence information


Nucleotide sequence

ATGCAGCAGAACAGCACTGTCACTGAGTTTATACTACTAGGATTGACACAGGATCCCCTG
AAGCAGAAAATGGTGTTTATAATCTTCTTAGTTTTCTATTTGGGGACTGTAGTGGGGAAT
ACACTCATTATTGTGACAATCAAGTTCAGTCGGACACTTGGGAGTCCCATGTACTTCTTC
CTATTTTATTTGTCCTTTTCTGATTCCTGTTTTTCAACATCCACAGCCCCAAGACTCATT
GTGGATGCCCTCTCTAAAAAGAACATCATTTCCTACAATGAATGCATGACACAAGTCTTT
GCTCTCCATTTATTTGGCTGCATGGATGTCTTTATCCTCATTTTCATGGCTGTTGACCGT
TATGTGGCCATCTGTAAACCCTTGCGTTACTCAGTCATCATGAGGCGGCAGGTCTGTGTT
ATCTTGATTATAGTTGCCTGGATAGGGTCTTTTTTACATTCCACTACTCAGATTGTTTTG
GCCTTGAGACTGCCCTTCTGTGGGCCCAATCTGATTGACCATTATTGCTGTGACTTACAG
CCATTATTGAAACTTGCCTGCATGGATACATACATGATAAATCTGCTGTTAGTGTTTAAC
AGTGGTGCCATTTGCTCAAGCAGTTTTGTAATTTTGATTATCTCATATTTTGTCATCTTA
CACTCTCTGCGAAACCATAGTGCAGAAGGGAGAAAAAAGGCACTCTCTACCTGCACATCT
CATATTATAGTAGTTATCTTATCCTTTGTACCCTGCATATTCATATATGCACGGCCACCA
ACTACTTTTCCTATGGACAAGATGGTAACAGTATTTTATACCATTGGAACACCATTTCTC
AACCCGATCATCTATACATTAAGGAATGCAGAAGTTAAAAATGCCATGAAAAAATTATGG
CATGTTAAATTTATCATGAAA


Conceptual translation

MQQNSTVTEFILLGLTQDPLKQKMVFIIFLVFYLGTVVGNTLIIVTIKFSRTLGSPMYFF
LFYLSFSDSCFSTSTAPRLIVDALSKKNIISYNECMTQVFALHLFGCMDVFILIFMAVDR
YVAICKPLRYSVIMRRQVCVILIIVAWIGSFLHSTTQIVLALRLPFCGPNLIDHYCCDLQ
PLLKLACMDTYMINLLLVFNSGAICSSSFVILIISYFVILHSLRNHSAEGRKKALSTCTS
HIIVVILSFVPCIFIYARPPTTFPMDKMVTVFYTIGTPFLNPIIYTLRNAEVKNAMKKLW
HVKFIMK