Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c11c Olfactory Receptor

Gene Symbol Or4c11c
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:88831119-88832039 (+)
Aliases Olfr1205, MOR230-3, Olfr1205-ps1, MOR230-3, Olfr1205-ps1

Sequence information


Nucleotide sequence

ATGCAGCAGAACAGCACTGTCACCGAGTTTATACTACTAGGATTGACACAGGATCCCCTG
AAGCAGAAAATGGTGTTTATAATCTTCTTAGTTTTCTATATGGGGACTGTAGTGGGGAAT
ACACTCATTATTGTGACAATCAAGTTCAGTCGAACACTTGGGGGTCCCATGTACTTCTTC
CTGTTTTATTTGTCCTTTGCTGATTCCTGCTTTTCAACGTCCACAGCCCCAAGACTCATT
GTGGATGCCCTTTCTAAAAAGAACATCATTTCCTACAATGAATGCATGACACAAGTCTTT
GCTCTCCATTTATTTGGCTGCATGGAGGTCTTTGTCCTCATTTTCATGGCTGTTGACCGT
TATGTGGCCATCTGTAAACCCTTGCATTACCCAGTCATCATGAGGCGGCAGGTCTGTGTC
ATCTTGATTATAGTTGCCTGGATAGGGTCTTTTCTACATTCCACTACTCAGATTGTTTTG
GCCTTGAGACTGCCCTTCTGTGGGCCCAATCTGATTGATCATTATTGCTGTGACTTACAG
CCCTTATTGGAGCTTGCCTGCATGGATACACACATGATAAATCTGCTGTTAGTGTTTAAC
AGTGGTGCAATTTGCTCAAGCAGTTTTTTAATTTTGATTATCTCATATTTTGTCATCTTA
TACTCTCTGCGAAACCACAGTGCTGAAGGGAGAAAAAAGGCACTCTCTACCTGCACATCT
CATATAATAGTAGTTGTCTTATCCTTTGGACCCTGCATATTCATATATGCACGTCCACCA
ACTACTTTTTCTATGGACAAGATGGTAACAGTATTTTTTACCATTGGATCACCCTTTCTC
AACCCGATCATCTATACATTAAGGAATGCAGAAGTTAAAAATGCCATGAAAAAATTATGG
CATGTTAAAATTATGACAGAA


Conceptual translation

MQQNSTVTEFILLGLTQDPLKQKMVFIIFLVFYMGTVVGNTLIIVTIKFSRTLGGPMYFF
LFYLSFADSCFSTSTAPRLIVDALSKKNIISYNECMTQVFALHLFGCMEVFVLIFMAVDR
YVAICKPLHYPVIMRRQVCVILIIVAWIGSFLHSTTQIVLALRLPFCGPNLIDHYCCDLQ
PLLELACMDTHMINLLLVFNSGAICSSSFLILIISYFVILYSLRNHSAEGRKKALSTCTS
HIIVVVLSFGPCIFIYARPPTTFSMDKMVTVFFTIGSPFLNPIIYTLRNAEVKNAMKKLW
HVKIMTE