Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c12 Olfactory Receptor

Gene Symbol Or4c12
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89943187-89944191 (-)
Aliases Olfr1259, RP24-166A20.3, MOR232-9, RP24-166A20.3, MOR232-9

Sequence information


Nucleotide sequence

ATGATTTCTCCTTTCTTTTCTCCTGAAGATAAAATATTTTTGGGGAGGGATTTAAGAAAA
ATTAACCATATCACACAGATGGAGAATAAAAGGAATGTGACTGAATTCATCTTGATAGGT
CTTACACAGAACCCCCAAATGCAGAAAGTAGTGTTCGTGACATTTTTGGTTCTATACATG
ACAACAATTTCAGGCAACCTCCTCATTGTGGTCACTATCATCAACAGCCAGGCTCTGAAT
TCCCCCATGTATTTCTTCCTGAGCCACCTCTCCTTGATAGATACAATTTACACTTCTTCT
TCAGCTCCAAAGCTGATTGCGGACTCCCTTCAAGAGAACAAAGTCATCTCCTTTAATGGA
TGCATGGCTCAAGTCTATGCAGAGCACATTTTTGGTGCTACTGAGATCATCCTATTGACA
GTGATGGCCTATGACCGCTATGTGGCCATCTGCAAACCTCTGCACTATATGACCATCATG
AGCCACAAGCTATGCATTCTCCTGGTGGGGGTAGCCTGGACTGGAGGATTTCTCCATGCA
ACTATTCAGATCCTTTTTACAGTGTGGCTGCCCTTCTGTGGCCCCAACATCATAGACCAT
TTTATGTGTGACTTGTATCCATTGTTGGAACTTGTTTGCATGGACACACACATCCTTGGT
CTCTTTGTGGCTGCCAACAGTGGGTTCATCTGCCTATTTAATTTCCTGCTCTTGATGGGA
TCCTATGTGATCATCTTGCGCTCTTTAAAGAACTATAGCTTAGAGGGCAGGCGCAAAGCC
CTCTCCACCTGTGTGTCTCATATCACAGTGGTAGTTTTATTCTTTATTCCTTGCATATTT
GTATATCTACGTCCAGTGACCACTTTGCCACTTGATAAAGGTGTTGCTGTGTTTTATACT
ATGGTGGCTCCTATGCTGAATCCTTTAATCTACACCCTCAGGAATGCTGAAGTAAAAAAT
GCAATCAAGAAGCTCTGGAGAAAAAAAGTAACTTCAGATAGTAAT


Conceptual translation

MISPFFSPEDKIFLGRDLRKINHITQMENKRNVTEFILIGLTQNPQMQKVVFVTFLVLYM
TTISGNLLIVVTIINSQALNSPMYFFLSHLSLIDTIYTSSSAPKLIADSLQENKVISFNG
CMAQVYAEHIFGATEIILLTVMAYDRYVAICKPLHYMTIMSHKLCILLVGVAWTGGFLHA
TIQILFTVWLPFCGPNIIDHFMCDLYPLLELVCMDTHILGLFVAANSGFICLFNFLLLMG
SYVIILRSLKNYSLEGRRKALSTCVSHITVVVLFFIPCIFVYLRPVTTLPLDKGVAVFYT
MVAPMLNPLIYTLRNAEVKNAIKKLWRKKVTSDSN