Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c121 Olfactory Receptor

Gene Symbol Or4c121
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:78,016,000-78,016,900 (-)
Aliases Olr687

Sequence information


Nucleotide sequence

ATGAACAGATTTTTATTCATCATCTTCTTAAGAATCATGCTAAACCAAAGCTATATCAAT
GAATTCATTCTCCTTGGACTTTCACAGAACTCAAAAGTTGAAAAAATATTGTTTGTTATA
TTTTTGTTGATCTACCTGGCAACGATTGGGGGCAACATGATTATTGTGGTGACCATCATC
TACAGCCCTGCACTACTGGGCTCCCCCATGTACTTCTTCTTGATATTCTTGTCCTTCCTG
GATGCATGCACTTCTTCCACTGTAACACCCAAGATGATGGTAGACTTCTTTCATGAGAGA
AAGACCATCTCCTTTGAATGTTGTATGACACAACTGTTTGCTGTCCACTTCTTCACTGGG
ATGGAGGTGATTGTCCTGTCAGCCATGGCTTATGACCGCTATGTAGCCATTTGCAAGCCC
CTTCACTACTCTTCTATCATGACCCGGAGGCTCTGTGGTATTTTAGTGCTGTTGTCCTGG
GCTGGAGGCTTCTTACATTCTATCATACAAATTATCTTTACTTTGCAGCTACCCTTCTGT
GGACCCAATATCATTGATCACTACATGTGTGACTTGTTCCCATTACTGAAGCTTGCCTGC
ACTGACACACACATTTTTGTCATTTTGGTGTTTGCCAACAGTGGGTCTATCTGCATCATA
ATATTCTCTATTTTGCTTGTTTCCTATGGTGTCATCTTGTTCTCTCTGAGAGCCCACAGT
TCTGAAGGCAGACGTAAAGCTCTTTCTACTTGTGGATCCCACATTACAGTTGTGCTTTTG
TTTTTTGTGTCATGCATCTTAATATATGCTCGACCTACAGCCTTCTCCTCTGAGAAAAAT
GCTCTTGTATTTGCAACCATCATAACACCACTGCTCAATCCTATGGTTTACACTTTCAGG
AATAAGGATATGAAGAATGCCATCAGGAAAATGTGGAAGAGATTGATAGTGGTTTCTGGT
GATTAT


Conceptual translation

MNRFLFIIFLRIMLNQSYINEFILLGLSQNSKVEKILFVIFLLIYLATIGGNMIIVVTII
YSPALLGSPMYFFLIFLSFLDACTSSTVTPKMMVDFFHERKTISFECCMTQLFAVHFFTG
MEVIVLSAMAYDRYVAICKPLHYSSIMTRRLCGILVLLSWAGGFLHSIIQIIFTLQLPFC
GPNIIDHYMCDLFPLLKLACTDTHIFVILVFANSGSICIIIFSILLVSYGVILFSLRAHS
SEGRRKALSTCGSHITVVLLFFVSCILIYARPTAFSSEKNALVFATIITPLLNPMVYTFR
NKDMKNAIRKMWKRLIVVSGDY