Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c123 Olfactory Receptor

Gene Symbol Or4c123
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89,296,400-89,297,300 (-)
Aliases Olfr1230

Sequence information


Nucleotide sequence

MENANNVTEFILVSITKIPELRILFSALFLIMYVATLLGNLLIIVTVTVSPNLRSPMYFF
LISLSLLDVIYSSVTAPKLIVDSLSENTTISLEGCMTQLFAEHFFGGVEIILLIVMAYDS
YVAICKPLHYTTIVSPRVCWLMVGGAWVGGFAHGTIQLLFMYQIPFCGPNVIDHVICDLF
PLLQLACMDTHILALLVILNSGVMCVTIFLILITSYVVILCSLKSSSSEGRRKALSTCSS
HFTVVVLFFVPCIILYMRPVVTYPIDNAMALCATIFEPMLNPLIYSLRNAEVKHALRKLW
MKRGP


Conceptual translation

MENANNVTEFILVSITKIPELRILFSALFLIMYVATLLGNLLIIVTVTVSPNLRSPMYFF
LISLSLLDVIYSSVTAPKLIVDSLSENTTISLEGCMTQLFAEHFFGGVEIILLIVMAYDS
YVAICKPLHYTTIVSPRVCWLMVGGAWVGGFAHGTIQLLFMYQIPFCGPNVIDHVICDLF
PLLQLACMDTHILALLVILNSGVMCVTIFLILITSYVVILCSLKSSSSEGRRKALSTCSS
HFTVVVLFFVPCIILYMRPVVTYPIDNAMALCATIFEPMLNPLIYSLRNAEVKHALRKLW
MKRGP