Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c125 Olfactory Receptor

Gene Symbol Or4c125
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89339386-89340300 (-)
Aliases Olfr1233, RP24-427F7.2, MOR238-1, RP24-427F7.2, MOR238-1

Sequence information


Nucleotide sequence

ATGAATGTGACTGAATTCATCCTCATGGGACTGACTCAGAACCCTCAGCTGCAGAGAATT
CTTCTTTTGATGCTTCTTATCATCTACATTGTCACTGTCACAGGAAACCTGCTCATTGTC
GGGACCATAGTCTGTAGCCAGACTTTGAACTCCCCAATGTACTTTTTCTTGGCCTTTTTA
TCTCTGATAGATGCATGCTATTCCTCTTCTATCATTCCTAAGATGCTAGCAGATTTGATG
TCAGAGAGAAAAACCATCTCATTCCATGGCTGCATGATACAACTTTTTGTTGAACATTTC
TTAGGAGCTTCAGAGATTGTTCTTCTTGTGGTCATGGCCTATGACCGCTATGTGGCCATC
TGTAGACCTCTGCACTATGTGACAAGGATGAACCACCACAATTGCTGTGTCCTAGTCGGG
GTATGTTGGATAATGGGTTTTCTCCACTCTTTTGGACAGATACTCGTTACTCTCTGGATT
CCTTTCTGTGGCCCCAATGTCATGGACCATTTCTGCTGTGACATTTTCCCGTTACTACAG
TTGGCCTGTGCAGACACTTTCCTTCTTGGTCTTCTCATTGCTGCAAATGGTGGTGTAATC
CCTGTGATCACCTTCACGATGCTATTGATGTCCTATGCGGTCATTCTCTTTTCCTTGAGG
ACACATAGCACTGCAGGGAGGAAAAAGGCCCTCTCTACCTGTAGCTCCCACATCACTGTT
GTTGTCTTGTTCTTTGTGCCATGCATTTATACATATATGCGGCCAGTAACAACTTTTCAT
ACAGATAAAGCCATAGCAGTGTTTTACACTCTTGTCACTCCCATGTTAAATCCAATTATC
TACACTGTAAGGAATGCAGAGGTTAAAAATGCCATTAGAATGATACTAAAAAAGAATTCA
ATCTTAGATAACAAA


Conceptual translation

MNVTEFILMGLTQNPQLQRILLLMLLIIYIVTVTGNLLIVGTIVCSQTLNSPMYFFLAFL
SLIDACYSSSIIPKMLADLMSERKTISFHGCMIQLFVEHFLGASEIVLLVVMAYDRYVAI
CRPLHYVTRMNHHNCCVLVGVCWIMGFLHSFGQILVTLWIPFCGPNVMDHFCCDIFPLLQ
LACADTFLLGLLIAANGGVIPVITFTMLLMSYAVILFSLRTHSTAGRKKALSTCSSHITV
VVLFFVPCIYTYMRPVTTFHTDKAIAVFYTLVTPMLNPIIYTVRNAEVKNAIRMILKKNS
ILDNK