Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c126 Olfactory Receptor

Gene Symbol Or4c126
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89993395-89994312 (+)
Aliases Olfr1261, RP24-314D20.1, MOR234-3, RP24-314D20.1, MOR234-3

Sequence information


Nucleotide sequence

ATGAGCAATGTCACAGAATTTATCCTCCTGGGCCTGACCCAAGACCCAGATCTGCAGAAA
TTCTTATTCATTGTGTGCTTAATAATCTATTTGATCACACTGGCTGGTAACATGCTCATC
TCAGTCACCATCTTCATCAGCCCAGCCCTGGCCACTCCCATGTACTTCTTTCTTTCCTAC
TTGTCCGTCATAGATGGTTTCTACTCTTCTTCCATAGCACCCAAAATGATCTATGACCTA
ATCTCTGAGAAGAGCACCATATCCTTCAATGGCTGCATGACTCAGCTTTTTGTGGAGCAT
TTTTTTGCTGCAGCTGAAATCATCTTGCTGATGTCCATGGCCTATGATCGCTATGTAGCC
ATCTGCAAGCCCTTGCACTACATGACCATCATGAACCGACCTCTGTGTGTATTCCTGGTG
GGGGCTGCTGTAATCTTAGGATTCATCCATGGAGGGATACAGATTTTGTTTATGGCCCAG
TTACCATTCTGTGGCCCAAATATCATTGATCACTTTATGTGTGATTTAATACCACTCCTG
GAGTTGGCCTGCACTGACACTCACACTCTGGGACCCCTGATCGCTGCCAACAGCGGGTCA
CTGTGTTTACTCATTTTCTCTATGCTGGTTGCTTCCTATGTGGTCATCCTTCGCTCCCTG
AGAAATCACAGTGCAGAAGGGCGTCGCAAAGCCCTGTCTACCTGTGCCTCTCATGTCACC
GTTGTTGTCTTATTCTTTGTTCCTTGTTCATACCTGTACCTAAGGCCCATGACCTCCTTC
CCCACTGACAAAGCTGTAACTGTGTTTTGCACCCTAGTGACACCTATGCTGAACCCTCTG
ATCTATACCCTCAGAAATGAGGAAGTCAAAAGGGTTATGAAGAAGCTCTGGGGTCGAATG
AGGAAAGCTGGTGACATG


Conceptual translation

MSNVTEFILLGLTQDPDLQKFLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSY
LSVIDGFYSSSIAPKMIYDLISEKSTISFNGCMTQLFVEHFFAAAEIILLMSMAYDRYVA
ICKPLHYMTIMNRPLCVFLVGAAVILGFIHGGIQILFMAQLPFCGPNIIDHFMCDLIPLL
ELACTDTHTLGPLIAANSGSLCLLIFSMLVASYVVILRSLRNHSAEGRRKALSTCASHVT
VVVLFFVPCSYLYLRPMTSFPTDKAVTVFCTLVTPMLNPLIYTLRNEEVKRVMKKLWGRM
RKAGDM