Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c127 Olfactory Receptor

Gene Symbol Or4c127
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:90,002,400-90,003,300 (+)
Aliases Olfr1262

Sequence information


Nucleotide sequence

MSNVTEFILLGLTQDPDLQKLLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSY
LSIIDGFYSSSITPKMIYDLISEKSTISFNGCMTQLFAEHFFAAAEIILLISMAYDRYVA
ICKPLHYMTIMNRHVCIFLVVAAGIVGFVHGMIQTTFIAQLPFCGPNIINHFICDLIPLL
ELACTDTHTLGPLIAANSGSMCLLIFSMLVASYVVILRSLRNHSAEGRRKALSTCASHVT
VVVLFFVPCSYLYVRPVISFHIDKIVSVFYTLVTPLLNPLIYTLRNEEVKRVMKKLLGSN
HVKH


Conceptual translation

MSNVTEFILLGLTQDPDLQKLLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSY
LSIIDGFYSSSITPKMIYDLISEKSTISFNGCMTQLFAEHFFAAAEIILLISMAYDRYVA
ICKPLHYMTIMNRHVCIFLVVAAGIVGFVHGMIQTTFIAQLPFCGPNIINHFICDLIPLL
ELACTDTHTLGPLIAANSGSMCLLIFSMLVASYVVILRSLRNHSAEGRRKALSTCASHVT
VVVLFFVPCSYLYVRPVISFHIDKIVSVFYTLVTPLLNPLIYTLRNEEVKRVMKKLLGSN
HVKH