Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c12b-ps Olfactory Receptor

Gene Symbol Or4c12b-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:78696775-78697897 (+)
Aliases Olr719-ps, Olr719-ps

Sequence information


Nucleotide sequence

AAAGATGTTTATTTGAGAAATACGTAATTATTTTATGATTCCTTTCTTTTCTAAAGGTAA
ATAGCCCTTTCTGGATTTAAAAACAAACTATACTGCACACATGGAGAATAAAAGGAATGT
GACTGAGTTCATCTTGATAGGTCTTACACAGAACCCCCAAATGCAGAAAGTAGTGTTTGT
GTCATTTTTGGTTTTGTACCTCATAACAATTTCAGGCAACCTGCTCATTGTGGTCACTGT
CATCAACAGTCAGGCTCTGAGTTCCCCAATGTATTTCTTCCTGAGCCACCTGTCTTTAAT
AGATACAATTTATACTTCTTCTTCAGCTCCAAAACTGATTGTGGACTCCCTTCAAGAGAA
CAAAGTCATCTCCTTTAATGGATGCATGGCTCAAGTCTATGCAGAGCACATTTTTGGTGC
TACTGAGATCATCCTGTTGACAGTGATGGCCTATGACCGCTATGTGGCCATCTGCAAACC
TCTGCATTATACGACCATCATGAACCACAAGCTATGCATTATCCTGGTGGGCGTGGCCTG
GACCGGAGGATTTCTCCATGCATCTATTCAGATCCTCTTTACAGTGTGGTTGCCCTTCTG
TGGCCCCAACATCATAGACCATTTTATGTGTGATTTGTACCCCTTGTTGGAACTTGTCTG
CATGGACACACACACCCTTGGTCTCTTTGTTGCTGCCAACAGTGGATTCATCTGCCTATT
TAACTTCCTGCTCTTGATGGGATCCTATGTGATCATCTTGCACTCTCTGAAAAACTATAG
CTTAGAGGGCAGGCGCAAAGCCCTCTCCACCTGTGTGTCTCACATCACAGTAGTTGTCTT
ATCCTTTATTCCTTGCATATTTGTGTATCTACGCCCAGTGACCACCCTGCCAATTGATAA
AGGTGTGCTGTATTTTATACTATGGTGGCCCCTCTACTGAATCCTTTAATCTACACTCTC
AGGAATTCTGAGGTAAAAAATGCAATAAGGAAGCTCTGGAGGAAAAATTATAAATTCAAA
TAATAATTAAACAAGGGTCTTTGGACATTACATACATGGGTAATGTATTAAGTCTCTTCT
TCAACTTTTTATTAATAGCTGGGAATATCAACTATAATGAATA


Conceptual translation

MENKRNVTEFILIGLTQNPQMQKVVFVSFLVLYLITISGNLLIVVTVINSQALSSPMYFF
LSHLSLIDTIYTSSSAPKLIVDSLQENKVISFNGCMAQVYAEHIFGATEIILLTVMAYDR
YVAICKPLHYTTIMNHKLCIILVGVAWTGGFLHASIQILFTVWLPFCGPNIIDHFMCDLY
PLLELVCMDTHTLGLFVAANSGFICLFNFLLLMGSYVIILHSLKNYSLEGRRKALSTCVS
HITVVVLSFIPCIFVYLRPVTTLPIDKGV/VFYTMVAPLLNPLIYTLRNSEVKNAIRKL
WRK