Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c12b Olfactory Receptor

Gene Symbol Or4c12b
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89816328-89817257 (+)
Aliases Olfr1255, RP23-270H4.4, MOR232-4, RP23-270H4.4, MOR232-4

Sequence information


Nucleotide sequence

ATGAATGACACTGAACACATGGAGAATAAAAGGAACGTGACTGAGTTCATCTTGATAGGT
CTTACACAGAACCCCCAAATGCAGAAAGTAGTGTTCGTGACATTTTTGCTTCTGTACATG
ATAACAATTTCAGGCAACCTGCTCATTGTGGTCACTGTCATCAACAGCCAGGCTCTGAAT
TCCCCCATGTATTTCTTCCTGAGCCACCTCTCCTTGATAGATACAATTTACACCTCTTCT
TCAGCTCCAAAGCTGATTGCGGACTCCCTTCAAGAGAACAAAGTCATCTCCTTTAATGGA
TGCATGGCTCAAGTCTATGCAGAGCACATTTTTGGTGCTACTGAGATCATCCTGTTGACA
GTGATGGCTTATGACCGCTATGTGGCCATCTGCAAACCTCTGCACTATATGACCATCATG
AGCCACAAGCTATGCATTCTCCTGGTGGGGGTAGCCTGGACTGGAGGATTTCTCCATGCA
ACTATTCAGATCCTTTTTACAGTGTGGCTGCCCTTCTGTGGCCCCAACATCATAGACCAT
TTTATGTGTGACTTGTACCCATTGTTGGAACTTGTTTGCATGGACACACACACTCTTGGT
CTCTTTGTTGCTGCCAACAGTGGGTTCATCTGCCTATTTAATTTCCTGCTCTTGATGGGA
TCCTATGTGATCATCTTGCGCTCTTTAAAGAACTATAGCTTAGAAGGCAGGCGCAAAGCT
CTCTCCACCTGTGTGTCACACATCACAGTAGTTGTTTTATCCTTTATTCCTTGCATATTT
GTATATCTACGTCCAGTGACCACTCTGCCAATTGATAAAGCTGTTGCAGTCTTTTATACT
TTGGTGGCCCCTCTACTGAATCCTTTAATCTACACCCTCAGAAATTCTGAGGTAAAAAAT
GCAATAAAGAAGCTCTGGAGGAAAAAAATA


Conceptual translation

MNDTEHMENKRNVTEFILIGLTQNPQMQKVVFVTFLLLYMITISGNLLIVVTVINSQALN
SPMYFFLSHLSLIDTIYTSSSAPKLIADSLQENKVISFNGCMAQVYAEHIFGATEIILLT
VMAYDRYVAICKPLHYMTIMSHKLCILLVGVAWTGGFLHATIQILFTVWLPFCGPNIIDH
FMCDLYPLLELVCMDTHTLGLFVAANSGFICLFNFLLLMGSYVIILRSLKNYSLEGRRKA
LSTCVSHITVVVLSFIPCIFVYLRPVTTLPIDKAVAVFYTLVAPLLNPLIYTLRNSEVKN
AIKKLWRKKI