Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c130-ps Olfactory Receptor

Gene Symbol Or4c130-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:76870000-76870896 (-)
Aliases Olr638-ps, Olr638-ps

Sequence information


Nucleotide sequence

ATGGGAAATCAAAACAATGTGACAGAGTTCATACTTTTGGGTCTTACTGAGAACCAGGAC
CTTCCGAAACTGTTTTCTGCTCTGTTTCTCATCATGTATGTGGTAATGTTATTAGGAAAT
ATGCTTATTGTGGTAACCATGGTTACAAGCCAGAGTTTAAGATCACCTATGTACTTTTTC
CTCACTTCTTTGTCCATAGTGGACATCCCGTATTCTTCTGTCATTGCCCCAAAGCTGATT
TTAGATTCCCTTTCTGCAAATAGTACTATCTCATTTGAAGGATGCATAGCCCAGCTCTTT
GCAGAATATTTCTTTGGAAGCATGGGGATCATTTTGCTTATTGTGATGGCCTACGACTTC
TACATTGCCATCTGTAAACCTCTCCACTACATGAATATCATGAGTCCTCGGAAGTGTTGT
ATACTCCTGGAGGGAGCTTGGGTAGGAGGATTACGACACACAACTATTCAGCTTATTTTC
ATGTATCAATAACCATTCTGTGGTCCTAGTATTATAGATCATTTTTTATGTGATTTGTTT
CAGTTGCTGATATTGGCATGCATGGATACTCATACACTGGGTCTCATTGTCATCTTTAAC
AGTGGGGTGATGTGTATAGCTATCTTCATTATTCTAATTGCCTCTTACATAACTATCCTG
TGTTTTCTCAAGACTCACAACTCTGAAGGGCGACGCAAAGCACTCTCCACTTGTGGCTCT
CACTTCACAGTTGTAGTGTTGTTCTTTGTACCATGTATTTTCTTATATGTGAGGCCTGTG
TCTACCTACCACATAGACAAGGCCATGACTGTGTCAGATTCAATTGTGACACCCATGCTG
AATCCGTTGATCTACACATTGAGGAATAAAGAGGTAAAAAATGCTATGAAGAAACTT


Conceptual translation

MGNQNNVTEFILLGLTENQDLPKLFSALFLIMYVVMLLGNMLIVVTMVTSQSLRSPMYFF
LTSLSIVDIPYSSVIAPKLILDSLSANSTISFEGCIAQLFAEYFFGSMGIILLIVMAYDF
YIAICKPLHYMNIMSPRKCCILLEGAWVGGLRHTTIQLIFMYQ*PFCGPSIIDHFLCDLF
QLLILACMDTHTLGLIVIFNSGVMCIAIFIILIASYITILCFLKTHNSEGRRKALSTCGS
HFTVVVLFFVPCIFLYVRPVSTYHIDKAMTVSDSIVTPMLNPLIYTLRNKEVKNAMKKL