Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c133-ps Olfactory Receptor

Gene Symbol Or4c133-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:76968848-76969642 (+)
Aliases Olr643-ps, Olr643-ps

Sequence information


Nucleotide sequence

ATGGCCAATCCAAACAATGTGACTGAATTTATTCTTTTGGGCGTTACTAAGAATTCAGAG
CTTAAAAAAATGTTCTCTGCTTTCTTTCTATTCATGTACTTGGCCACAGTGTTGGCAAAT
GTACTCATTGTAATAACTATTACCAAAAGTCACAGTCTGAGGTCACCCATGTACTTCTTC
CTCACTTCTTTGTCCTTTATAGATGTCACTTATTCATCTGTCACTGCTCCCAAGTTAATT
GTGGATGGCCTTTCCAACCGAACAACCATCTCCTTTGGAGGATGCATGACACAGCTCTTT
GCTGACCATTTTTTAGGTAGTGTAGGGATCATTCTTCTCATTGTAATGGCTTATGACCGC
TACATAGCCATCTGTAAACCCCTGCATTACATGACTATAATAACTCCTCGAGTATGCTGC
TTGATGGTGGGAGGAGCTTGCGTAGGAGGATTCATGCATGCAACTGTTCAGCTTCTCTTC
ATGTATCAAATACCTTTCTGTGGCCCCAATATAATTGACCATTTTATGTGTGACTTGTTT
CCATTGTTGCAACTAGCTTGTAAGAACACACAGATCCTGGGTTTCTTAGTCATTCTCAAT
AGCGGGGTGATGTGTGTGACCATTTTCCTTATTCTTATTACTTCCTATGTAGTCATCCTC
TATTCACTAAAGTCTTGTAGCTCTGAAGGAAGGCAGAAAGCCCTCGCCACATGTAGTTCT
CACTTCACTGTGGTTGTATTGTTCTTTGTACCTTGTATTTTCTTGTACAAAGAAAATTTT
CTTGTACCTCATGGA


Conceptual translation

MANPNNVTEFILLGVTKNSELKKMFSAFFLFMYLATVLANVLIVITITKSHSLRSPMYFF
LTSLSFIDVTYSSVTAPKLIVDGLSNRTTISFGGCMTQLFADHFLGSVGIILLIVMAYDR
YIAICKPLHYMTIITPRVCCLMVGGACVGGFMHATVQLLFMYQIPFCGPNIIDHFMCDLF
PLLQLACKNTQILGFLVILNSGVMCVTIFLILITSYVVILYSLKSCSSEGRQKALATCSS
HFTVVVLFFVPCIFLYKENFLVPHG/VVAYPIDKSMALCATIVEPMLNPLIYSLRNAEV
KHALRKLWIK