Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c134-ps Olfactory Receptor

Gene Symbol Or4c134-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:77038631-77038942 (+)
Aliases Olr647-ps, Olr647-ps

Sequence information


Nucleotide sequence

GCCTGCATGGATTCCTATGTGAAAAATTTGCTAGTTCTGTCTAATAGTGGTGCCATATGC
ATGGTAAGTTTCACAGTGCTTCTTATGTCCTATGTTGTAATCTTATGCTCTCTGAGAAAC
CACAGTGAAGAAGGAAGACAAAAAGCCTTGTCTACTTCTCATTTCATTGTGGTGGTCATA
ATTTTTGGTTCCTGTTTATATACACACAGCCAATAACCAAAGAACAAGATGGTATTGTTG
TTTTATACCTCTGAGACACCTCTGCTCAACCTTCTTATCTACAGTCTGAGGAATGAAGAA
GTAAAAAAAATT


Conceptual translation

NNTVTEFILFGLT/DPEKQKAVFGFSILYLMILMGNFLILVTIKIFRHL/SPMYFFLL
YLSFSDASFSIT/ST*REPRLIMDYLF*NKNITYNKCMTQVFEVHFFGYMEIL/LILV
TFDLYIAICKPLRYKTMVKQYIYDILMVLL*VGFCIHSSAQIF*HLILGFCSPNVTDHF*
CDL*PLMKL\CMDSYVKNLLVLSNSGAICMVSFTVLLMSYVVILCSLRNHSEEGRQKAL
STSHFIVVVIIFGSCLYTHSQ*PKNKMVLLFYTSETPLLNLLIYSLRNEEVKKI