Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c15b Olfactory Receptor

Gene Symbol Or4c15b
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89282199-89283194 (-)
Aliases Olfr1229, MOR233-19, MOR233-22, MOR233-19, MOR233-22

Sequence information


Nucleotide sequence

ATGTTTATCATCATTGCCAAATTATACATTCTCTATTGGGCATTCATCTTTTCCTTGGAA
ACCATGCAAAACCAGAGTTTTATAACGGAATTTGTCTTCCTGGGACTTTCACAGAATCCA
AATGTTCAAAAAATAATATTTGTCATATGTTTACTTGTCTACATTGCAACTATTGGGGGC
AATATGATGATTGTGGTGACTGTTGTTTCTACTCCGGCACTGCTCGGCTCACCCATGTAT
TTCTTCCTGGCCTTCTTGTCTCTATTGGATGCAAGCTTCTCCTCTGCCATGACACCCAAA
ATGATTGTAGATTCTCTCTATGAGAGAAAAACCATCTCCTTTGAAGGATGCATGATACAA
CTTTTTGCTGAACATTTCTTTGGAGGGGCTGAGGTGATTGTCCTGTCAGCCATGGCCTAT
GACCGCTATGTTGCTATTTGCAAGCCCTTGCACTACTCTTCCATCATGACCCTGAGGCTC
TGTGGTACTCTAGTGGGAGTGGCCTGGACAGGAGGATTCTTACACTCTATCATCCAAATT
ATCTTCACTTTGCAGCTGCCTTTCTGTGGACCCAATATCATTGATCACTTCATATGTGAC
TTGTACCCATTACTGGAACTTGCTTGCACTGACACTCACATCTTTGGCCTTTTGGTGGTT
GCCAACAGTGGCTTTATCTGCATCATAATCTTCACTTTGTTGCTTGTCTCTTATGGTTTT
ATCTTGCTGTCTCTGAGATCTCATAGTTCTGAAGGACGATGGAAAGCTCTATCCACTTGT
GGATCCCATATTGCTGTTGTGGTCTTGTTCTTTGTTCCATGCATATTTACATATGCAAGG
CCTCCCACTGCCTTTTCCTTTGACAAAATGGTAGCAATATTTTACACCATGCTATCCCCC
TTGCTTAATCCTATGATTTATACTTTTAGGAATAAGGACATGAAAAATGCCATAAGGAAA
ATGTGGACGAGATTGATAGTACATTCAGATAAAAAA


Conceptual translation

MFIIIAKLYILYWAFIFSLETMQNQSFITEFVFLGLSQNPNVQKIIFVICLLVYIATIGG
NMMIVVTVVSTPALLGSPMYFFLAFLSLLDASFSSAMTPKMIVDSLYERKTISFEGCMIQ
LFAEHFFGGAEVIVLSAMAYDRYVAICKPLHYSSIMTLRLCGTLVGVAWTGGFLHSIIQI
IFTLQLPFCGPNIIDHFICDLYPLLELACTDTHIFGLLVVANSGFICIIIFTLLLVSYGF
ILLSLRSHSSEGRWKALSTCGSHIAVVVLFFVPCIFTYARPPTAFSFDKMVAIFYTMLSP
LLNPMIYTFRNKDMKNAIRKMWTRLIVHSDKK