Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c29 Olfactory Receptor

Gene Symbol Or4c29
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:***************** (-)
Aliases Olfr1209, RP23-260B13.2, MGC129175, MOR230-7, RP23-260B13.2, MGC129175, MOR230-7

Sequence information


Nucleotide sequence

ATGTGGCTGAATAACAATGTGACTGAATTCATTTTACTTGGTTTGACACAGGATCCTTTT
AGGAAGAAAATCCTATTTGTTGTGTTTTTGCTTTTTTACATGGGGACATTACTGGGTAAC
TTGCTTATCATTGCTACAATCAAGACAAGCCAGACCCTTGGGAGTCCCATGTACTTCTTC
CTGTTCTACTTATCCTTGTCTGACACCTGCTTCTCTACAACCATAGCTCCAAGAACAATT
GTGGACTCTTTGCTTAAGGAAGCCTCTATATCTTTCACTGAGTGCATAATCCAAGTCTTT
ACATTTCATTTCTTTGGCTGTCTGGAGATCTTTATCCTTATCCTCATGGCTGTGGACCGA
TATGTGGCCATCTGTAAGCCCCTGCACTACATGACCATCATGAGCCGCCGGGTCTGTGGG
GTGTTGGTGGCCATAGCCTGGGTGGGATCCTGTGTTCATTCTTTAGTTCAGATATTTCTG
GCCTTGAGTTTGCCCTTCTGTGGCCCCAATGAAATTGATCACTATTTCTGTGACTTGCAG
CCACTATTGAAGCTTGCCTGTTCAGACACATATTTGATCAACCTGCTTCTGGTGTCCAAC
AGTGGAGCCATTTGTACAGTGAGTTTCCTCATGCTGATGGTCTCTTATGTCATTATTCTT
CGTTCTCTAAGAAACCACAGTGCTGAAGGGAGGAGGAAAGCCCTATCTACCTGCATATCC
CACATTATTGTGGTCATCCTGTTCTTTGGACCTTGCATCTTTATATACACACGCCCTGCA
ACAACATTTCCTATGGACAAGATGATAGCTATATTTTATTCAATTGGTACACCTTTGCTC
AATCCTCTGATTTACACACTGAGGAATGCAGAGGTGAAAAATGCCATGAAGAAGTTATGG
AGAAAGAAAGTGGTCTCAGATGATCGAAAG


Conceptual translation

MWLNNNVTEFILLGLTQDPFRKKILFVVFLLFYMGTLLGNLLIIATIKTSQTLGSPMYFF
LFYLSLSDTCFSTTIAPRTIVDSLLKEASISFTECIIQVFTFHFFGCLEIFILILMAVDR
YVAICKPLHYMTIMSRRVCGVLVAIAWVGSCVHSLVQIFLALSLPFCGPNEIDHYFCDLQ
PLLKLACSDTYLINLLLVSNSGAICTVSFLMLMVSYVIILRSLRNHSAEGRRKALSTCIS
HIIVVILFFGPCIFIYTRPATTFPMDKMIAIFYSIGTPLLNPLIYTLRNAEVKNAMKKLW
RKKVVSDDRK