Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c3 Olfactory Receptor

Gene Symbol Or4c3
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:90021141-90022064 (-)
Aliases Olfr1264, RP24-314D20.4, MOR236-1, Mor16, Ors16, RP24-314D20.4, MOR236-1, Mor16, Ors16

Sequence information


Nucleotide sequence

ATGGAAATACCACACAATATTACAGAGTTTTTTATGCTGGGACTTTCTCAGAGGCCAGAG
ATCCAGAGACTTCTCTTTGTGGTCTTCTTGGTTATCTATGCAGTCACAGTTTGTGGCAAC
ATGCTCATTGTGGTCACTGTCACCTTCAGCTCCAGCCTGGCTTCTCCCATGTATTTCTTC
CTTTCCAATCTATCCTTTATTGACACCTGCTATTCCTCTTCTTTGGCGCCTAAACTTATT
GCTGATTCCTTGTATGAAGGGACGACTCTTTCTTATGAGGGCTGCATGGCCCAGCTCTTT
GGAGCTCATTTCCTGGGAGGTGTTGAGATCATTCTGCTCACAGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAACCCCTGCACTATACCACCACCATGACCAGGCACCTTTGTGTC
GTGCTGGTGGCGGTGGCTTGGCTGGGTGGTTTCCTGCATTCGTTGGTTCAGATCCTTCTG
ATTTTTCAGTTGCCTTTCTGTGGACCCAATGTAATAAACCACTTTGTGTGTGACTTGTAT
CCTTTACTGGAGCTGGCCTGCACCAACACATACGTCATCGGCCTGCTGGTGGTGGCCAAC
AGTGGTGTGATTTGCCTGCTGAACTTCCTCATGTTGGCTGCCTCGTACATTGTCATCTTG
CACTCTTTGCGGTCCCACAGTGCAGAGGGGAGACGGAAAGCTCTGTCTACCTGTGGGGCT
CACTTCACTGTGGTTACTATGTTCTTTGTGCCCTGTATATTTAGTTATATGCGTCCATCG
ACTACTTTACCTATAGATAAAAACATGGCAGTGTTTTATGGTATTCTCACACCCATGTTG
AATCCACTCATTTATACTCTGAGAAATGAAGAAGTGAAAGATGCCATGAGAAAGCTCTTC
ACACGCTCAGAAGTTGTAGGTGCC


Conceptual translation

MEIPHNITEFFMLGLSQRPEIQRLLFVVFLVIYAVTVCGNMLIVVTVTFSSSLASPMYFF
LSNLSFIDTCYSSSLAPKLIADSLYEGTTLSYEGCMAQLFGAHFLGGVEIILLTVMAYDR
YVAICKPLHYTTTMTRHLCVVLVAVAWLGGFLHSLVQILLIFQLPFCGPNVINHFVCDLY
PLLELACTNTYVIGLLVVANSGVICLLNFLMLAASYIVILHSLRSHSAEGRRKALSTCGA
HFTVVTMFFVPCIFSYMRPSTTLPIDKNMAVFYGILTPMLNPLIYTLRNEEVKDAMRKLF
TRSEVVGA