Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c31 Olfactory Receptor

Gene Symbol Or4c31
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:***************** (+)
Aliases Olfr1183, RP23-209L8.5, MOR230-6, RP23-209L8.5, MOR230-6

Sequence information


Nucleotide sequence

ATGCATAACTATAGTGTTACTGAGTTTATTCTTTTTGGATTGACACAGGATCCAGAAAAA
CAGAAGGCAATATTTGGAGTCTTCTTGATTCTTTACCTTATGACTTTAATAGGGAACTTC
CTCATCGTGATGACCATTAAGATGAGTCAGACACTTGGGAGTCCCATGTACTTTTTCCTC
TTCTATTTGTCTTTCGCTGATGCTTGCTTCTCTACAACTACAGCACCTAGATTGATCATA
GACGCCCTCTCGCAGAAAAAAATTATTACTTATAATGAATGTATGACTCAGGTCTTTGCA
GCTCACTTCTTTGGGTGCATGGAGATCTTCGTGCTTATCCTCATGGCCATTGACCGCTAT
GTAGCAATTTGTAAGCCTCTCAGATATACAACTATAATGAGCCAACGTATTTGTGGCATA
TTAGTGATTCTTGCCTGGGTAGGGTCTTGTATTCACTCTTCAGCACAGATTTTCTTAGCC
TTAAGATTACCATTCTGTGGCCCAAATGTGATTGATCATTATTTCTGCGATTTGCAGCCC
TTATTGAAACTTGCCTGCATGGATACCTATGTGATAAACTTGCTAGTTGTGTCTAATAGT
GGTGCCATATGTATGGTAAGTTTCACACTACTGCTTATCTCCTATATTTTCATCTTATAC
TCTCTGAGAAATCACAGTGTAGAAGGAAGACGAAAGGCCTTGTCTACATGCACTTCTCAT
TTCATTGTGGTGGTCATATTTTTTGGCCCCTGTATATTTATATACACACGCCCACCAACC
ACCTTCCCAATAGACAAGATGGTGTCTGTGTTTTATACAATTGGAACACCTTTGCTCAAC
CCTCTTATCTATACTCTGAGGAATGCAGAAGTAAAAATTGCCATGAAAAAATTGTGGTGT
GGTAAAGTA


Conceptual translation

MHNYSVTEFILFGLTQDPEKQKAIFGVFLILYLMTLIGNFLIVMTIKMSQTLGSPMYFFL
FYLSFADACFSTTTAPRLIIDALSQKKIITYNECMTQVFAAHFFGCMEIFVLILMAIDRY
VAICKPLRYTTIMSQRICGILVILAWVGSCIHSSAQIFLALRLPFCGPNVIDHYFCDLQP
LLKLACMDTYVINLLVVSNSGAICMVSFTLLLISYIFILYSLRNHSVEGRRKALSTCTSH
FIVVVIFFGPCIFIYTRPPTTFPIDKMVSVFYTIGTPLLNPLIYTLRNAEVKIAMKKLWC
GKV