Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c31 Olfactory Receptor

Gene Symbol Or4c31
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:76751603-76752511 (+)
Aliases Olr633, Olr633

Sequence information


Nucleotide sequence

ATGCATAACAACAGTGTGACTGAATTTATTCTATTTGGATTGACACGGGATCCAGAGAAA
CAGAAGGCAATATTTGGAGTCTTCTTGATTCTTTATCTTATGACATTACTGGGGAATTTT
CTCATTGTGGTAACCATTAAGATGAGTCAGACACTTGGGGGTCCCATGTTCTTTTTCCTC
TTCTATTTGTCTTTTGCTGACGCTTGCTTCTCTACGACTACAGCACCTAGATTGATCTTG
GACTCCCTCTCCCAGAAAAAAATTATTACCTACAATGAATGTATGACTCAGGTCTTTGCA
GCCCACTTCTTTGGGTGCATGGAGATCTTTGTGCTTATCCTCATGGCCTTTGACCGCTAT
GTAGCAATCTGTAAGCCTCTAAGGTACACAACTGTAATGAGCCAACGTATCTGTGGTTTA
TTAATTATTCTTGCCTGGGTAGGGTCTTGTATCCACTCTACAGCACAGATTATCTTGGCT
TTAAGATTACCATTCTGTGGCCCAAATATAATTGATCACTATTTCTGTGATTTGCAGCCC
TTGCTGAAACTTGCCTGCATGGATACCTATGTGATAAATTTGCTAGTTGTGTCTAATAGT
GGTGCCATATGCATGGTAAGTTTCATAGTGCTTCTTATGTCCTATGTTGTAATCTTATAC
TCTCTGAGAAACCACAGTGTGGAAGGAAGACGAAAGGCCTTGTCTACGTGCACTTCTCAT
TTCATCGTGGTGGTTATATTTTTTGGTCCCTGCATATTTATATACACTCGCCCACCAACC
ACCTTCCCAATAGATAAGATGGTATCTGTGTTTTATACAATTGGGACACCTTTGCTCAAC
CCTCTTATTTACACTCTAAGGAATGCAGAAGTAAAAAATGCCATGAAAAAAATATGGTGT
GGTAAAGGA


Conceptual translation

MHNNSVTEFILFGLTRDPEKQKAIFGVFLILYLMTLLGNFLIVVTIKMSQTLGGPMFFFL
FYLSFADACFSTTTAPRLILDSLSQKKIITYNECMTQVFAAHFFGCMEIFVLILMAFDRY
VAICKPLRYTTVMSQRICGLLIILAWVGSCIHSTAQIILALRLPFCGPNIIDHYFCDLQP
LLKLACMDTYVINLLVVSNSGAICMVSFIVLLMSYVVILYSLRNHSVEGRRKALSTCTSH
FIVVVIFFGPCIFIYTRPPTTFPIDKMVSVFYTIGTPLLNPLIYTLRNAEVKNAMKKIWC
GKG