Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c31b Olfactory Receptor

Gene Symbol Or4c31b
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:76790027-76791112 (+)
Aliases Olr635, Olr635

Sequence information


Nucleotide sequence

ATGTTGACATTGTGGAAGGTGTTTCAGGGATTTCAAAGGCAGATGAGAATAACAGCATGC
AGTAGAGCCAAGGAATTTCAATATCTGTGTCTCAGTATGTCATTTCTTTGTTTGCAGGTA
AAATATTTTCAGCCATTACTACCTAATATAGCCACTGATATGATGCATAACAACAGTGTG
ACTGAATTCATTCTGTTGGGGTTGACTCAGGATTCAGAAAAACAGAAGGCAATATTTGGA
GTCTTCTTGATTCTTTATCTTATGACATTACTGGGGAATTTTCTCATTGTGGTAACCATT
AAGCTGAGTCAGACACTTGGAAGTCCCATGTACTTTTTCCTCTTCTATTTATCTTTTGCT
GATGCTTGCTTTTCTACGACAACAGCACCTCGATTGATCGTGGACTCCCTCTTCCAGAAA
AAAATTATTACCTACAATGAATGTATGACACAGATCTTTGCAGCCCACTTCTTTGGGTGC
ATGGAGATCTTTGTGCTTATCCTCATGGCCTTTGACCGCTATGTAGCAATCTGTAAGCCT
CTAAGATATACAACTATAATGAACCAGCACATCTGTGGTATATTGGTAATTCTTGCCTGG
GTAGGGTCTTGTATCCACTCTTCAGCACAGATTATCTTGGCCTTAAGATTACCGTTCTGT
GGACCAAATGTAATTGATCACTTTTCCTGTGATTTGCAGCCCTTGTTGAAACTTGCCTGC
ATGGATACCTATGTGATAAATTTGCTAGTTGTGTCTAATAGTGGTGCCATATGCACGGTA
AGTTTCATAGTACTGCTCATCTCCTATATTGTAATCTTATACTCTCTGAGAAACCACAGT
GCAGAAGGAAGACGAAAGGCCTTGTCTACATGCACTTCTCATTTCATTGTGGTGGTCATA
TTTTTTGGTCCCTGTATATTTATATACACACGGCCACTAATCACTTTGCCAATAGATAAG
ATGGTATCTGTGTTTTATGCAATAGCAACACCTTTGCTCAACCCTCTTATCTATACTCTG
AGGAATGCAGAAGTAAAAAATGCCATGAAAAAAATATGGTGTGGTAAAGCATTGATAAAG
AATATA


Conceptual translation

MLTLWKVFQGFQRQMRITACSRAKEFQYLCLSMSFLCLQVKYFQPLLPNIATDMMHNNSV
TEFILLGLTQDSEKQKAIFGVFLILYLMTLLGNFLIVVTIKLSQTLGSPMYFFLFYLSFA
DACFSTTTAPRLIVDSLFQKKIITYNECMTQIFAAHFFGCMEIFVLILMAFDRYVAICKP
LRYTTIMNQHICGILVILAWVGSCIHSSAQIILALRLPFCGPNVIDHFSCDLQPLLKLAC
MDTYVINLLVVSNSGAICTVSFIVLLISYIVILYSLRNHSAEGRRKALSTCTSHFIVVVI
FFGPCIFIYTRPLITLPIDKMVSVFYAIATPLLNPLIYTLRNAEVKNAMKKIWCGKALIK
NI