Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c31f-ps Olfactory Receptor

Gene Symbol Or4c31f-ps
Organism Rat
Family 4
Subfamily c
Pseudo Yes
Location chr3:76662044-76662952 (+)
Aliases Olr627-ps, Olr627-ps

Sequence information


Nucleotide sequence

ATGAATAACAACACCGTGACAGAATTCATTCTGTTAGGATTAACACAGGATCCAGAAAAA
CAGAAGGCAATATTTGGAATCTTCTTGATTCTTTACCTTATGACATTATTGGGGAATTTT
CTCATTGTGATAACCATTAAGATGAGTCATACACTTGGAAGTCCCATCTACTTTTTCCTC
TTCTATTTGTCTTTTGCTGACGCTTGCTTCTCTACGACTACAGCACCTAGCTTGATCTTC
GACTCCCTCACCCAGAAAAAAATTATTACCTACAATGAATGTATGACTCAAGTCTATGCA
CTTCACTTCTTTGGGTGCATGGAGATCTGTGTGCTTATCCTCATGGCCTTTGACCGCTAT
GTAGCAATCTGTAAGCCTCTAAGGTACACAACTATAATGAGCCAACGTATCTGTGGTTTA
CTAGTGGTTCTTGCCTGGGTAGGGTCTTGTATTCACTCTACAGCACAGATTATCTTGGCC
TTAAGATTACCATTCTGAGGCCTGAATATAATTGATCACTATTTCTGTGATTTACAGCCC
TTGCTGAAACTTGCCTGCATGGATACCTATGTGATAAATTTGCTAGTTGTGTCTAATAAT
GGTGCCATATGCACAGTAAGTTTCATAGTACTGCTTATCTCCTATATTGTAATCTTATAC
TCTCTGAGAAACCACAGTGCAGAAGGAAGACCAAACGCCTTGTCTACATGCACTTCTCAT
TTCATTGTGGTGGTTCTATTTTTTGGTCCCTGTATATTCATATACACTCGCCCACCAACC
ACTTTTCCAATAGATAAGATGGTATCTGTGTTTTATACAATTGGGACACCTTTGCTCAAC
CCTCTTATTTATACTCTAAGAAATGCTGAAGTAAAAACTGCCATGAAAAAATTATGGTGT
GGTAAAGTA


Conceptual translation

MNNNTVTEFILLGLTQDPEKQKAIFGIFLILYLMTLLGNFLIVITIKMSHTLGSPIYFFL
FYLSFADACFSTTTAPSLIFDSLTQKKIITYNECMTQVYALHFFGCMEICVLILMAFDRY
VAICKPLRYTTIMSQRICGLLVVLAWVGSCIHSTAQIILALRLPF*GLNIIDHYFCDLQP
LLKLACMDTYVINLLVVSNNGAICTVSFIVLLISYIVILYSLRNHSAEGRPNALSTCTSH
FIVVVLFFGPCIFIYTRPPTTFPIDKMVSVFYTIGTPLLNPLIYTLRNAEVKTAMKKLWC
GKV