Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c52 Olfactory Receptor

Gene Symbol Or4c52
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:90014932-90015849 (+)
Aliases Olfr1263, RP24-314D20.3, MOR234-2, RP24-314D20.3, MOR234-2

Sequence information


Nucleotide sequence

ATGAGCAATGTCACAGAATTCATTCTCCTGGGCCTGACCCAAGACCCAGATCTGCAGAAA
CTCTTATTTATTGTGTGCTTAATAATCTATTTGATCACACTGGCAGGTAACATGCTCATC
TCAGTCACCATTTTCATCAGCCCAGCCCTGGCCACTCCCATGTACTTCTTTCTGTCCTAC
TTGTCCATCATAGATGGTTTCTACTCTTCTTCCATAGCACCCAAAATGATCTATGACCTA
ATCTCTGAGAAGAGCACCATATCCTTCAATGGCTGCATGACTCAGCTTTTTGCTGAGCAC
TTTTTTGCTGCTGATGAAATCATCTTGTTGATTGCCATGGCCTATGATCGCTATGTAGCT
ATCTGCAAGCCCTTACACTACATGACCATCATGAGCCAACCTCTGTGTGTATTCCTGGTG
GGTGCCGCTGTAATCTTAGGATTCATTCACGGAGCAATACAAACTTTATTTATGGCCCAG
TTACCCTTCTGTGGTCCCAATACCATCAACCATTTTATGTGTGATTTAATACCACTCCTG
GAGTTGGCCTGCACTGACACTCACACTCTGGGACCCCTGATCGCTGCCAACAGCGGGTCA
CTGTGTTTGCTTACTTTCTCTATGCTGGTTGCTTCCTATGTGGTCATTCTTCGCTCCCTG
AGAAATCACAGTGCAGAAGGGCGTCGCAAAGCCCTGTCTACCTGTGCCTCTCATGTCACC
GTTGTTGTCTTATTCTTTGTTCCTTGTTCATACCTGTACCTAAGGCCCATGACCTCCTTC
CCCACTGACAAAGCTGTAACTGTGTTTTGCACCCTAGTGACACCTATGCTGAACCCTCTG
ATCTATACCCTCAGAAATGAGGAGGTCAAAAGGGTTATGAAGAAGCTCTGGGGTCGAATG
AGGAAAGCTGGTGACATG


Conceptual translation

MSNVTEFILLGLTQDPDLQKLLFIVCLIIYLITLAGNMLISVTIFISPALATPMYFFLSY
LSIIDGFYSSSIAPKMIYDLISEKSTISFNGCMTQLFAEHFFAADEIILLIAMAYDRYVA
ICKPLHYMTIMSQPLCVFLVGAAVILGFIHGAIQTLFMAQLPFCGPNTINHFMCDLIPLL
ELACTDTHTLGPLIAANSGSLCLLTFSMLVASYVVILRSLRNHSAEGRRKALSTCASHVT
VVVLFFVPCSYLYLRPMTSFPTDKAVTVFCTLVTPMLNPLIYTLRNEEVKRVMKKLWGRM
RKAGDM