Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c58 Olfactory Receptor

Gene Symbol Or4c58
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89844069-89844971 (-)
Aliases Olfr48, RP23-270H4.6, C3, IC3, MOR232-5, RP23-270H4.6, C3, IC3, MOR232-5

Sequence information


Nucleotide sequence

ATGAATAATATCACCGAATTCATCCTTGTGGGCTTGACTCAGAACATGGAGCTTCAGATA
TTTTCATTTGTCGTATTTTTCATTGTCTATCTGCTCACCTTGGCTGGCAACCTGCTTATC
ATGGTCACCATCAGCAGCAGCAAGGCCCTGGGATCCCCGATGTATTTCTTCCTCTCTTTC
CTGTCGCTGATAGATGGCTGCTGCTCCTCGTCCATGACTCCTAAGATGCTGGCTGACTCT
CTCTCTGTGCGGAAAACCATTTCTTTCAGTGGCTGCATGACTCAAGTCTTTGCCGAGCAT
TTTTTCGGGGCTGCTGAGATTATTCTTCTCACAGTGATGGCCTACGACCGCTATGTGGCC
ATCTGTAAACCGCTGCGCTACACGATCATTATGAACAGATTTGTGTGTGGCCTCTTGGTG
GGGGTGGCCTGGGCTGGGGGTTTTATTCATGCGACCATTCAGATCCTCTTCACAGTCTGG
CTGCCTTTCTGTGGTCCCAATGTCATAGACCACTTTATGTGTGACCTGACCCCTTTGCTG
AAACTTGTTTGTATGGACACACACAACCTGGGTCTCTTTGTTGCTGCCAACAGTGGCTTT
ATCTGCCTGTTAAACTTTCTACTTCTGATGATCTCTTATATAGTCATCCTCGATGCTCTA
AAATCTCACAGCAAGGAGGGAAGGTGCAAAGCCCTCTCCACCTGTGTCTCTCACATTACT
GTGGTCATCTTATTCTTTGTGCCTTGCATATTTGTGTATCTTCGCCCAGTAATTACCTTC
TCTATTGATAAAGCGGTGGCTGTATTTTATACCATGATTACTCCTATGTTAAACCCCTTA
ATCTACACTCTCAGAAATACTGAGGTTAAAAATGCTATGAAGAAACTCTGTATCAAAGTT
GAT


Conceptual translation

MNNITEFILVGLTQNMELQIFSFVVFFIVYLLTLAGNLLIMVTISSSKALGSPMYFFLSF
LSLIDGCCSSSMTPKMLADSLSVRKTISFSGCMTQVFAEHFFGAAEIILLTVMAYDRYVA
ICKPLRYTIIMNRFVCGLLVGVAWAGGFIHATIQILFTVWLPFCGPNVIDHFMCDLTPLL
KLVCMDTHNLGLFVAANSGFICLLNFLLLMISYIVILDALKSHSKEGRCKALSTCVSHIT
VVILFFVPCIFVYLRPVITFSIDKAVAVFYTMITPMLNPLIYTLRNTEVKNAMKKLCIKV
D