Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4c99 Olfactory Receptor

Gene Symbol Or4c99
Organism Rat
Family 4
Subfamily c
Pseudo No
Location chr3:76591975-76592886 (+)
Aliases Olr624, Olr624

Sequence information


Nucleotide sequence

ATGATGCATAACAACAGTGTGACTGAATTCATTTTGTTGGGGTTGACTCAGGATTCAGAA
AAACAGAAGGCAATATTTGGAGTCTTCTTGATTCTTTATCTTATGACATTACTGGGGAAC
TTTCTCATTGTGGTGACCATTAAGATGAGTCACACACTTAGCAGTCCCATGTACTTTTTC
CTCTTCTATTTGTCTTTTGCTGATGCTTGCTTCTCTACAACTACAGCACCTCGATTGATC
GTGGACTTACTCTTCCAGAAAAAAGTTATTACCTACAATGAATGTATGACTCAGCTCTTT
GCAGCCCACTTCTTTGGGTGCATGGAGATCTTTGTGCTTATCCTTATGGCCTTTGACCGC
TATGTAGCAATTTGTAAGCCGCTAAGGTACACTATTATAATGAACCAACGCATCTGTGGT
ATATTGGTAATTCTTGCCTGGTTAGGGTCTTGTATCCACTCTTTAGCACAGATTTTCTTG
GCTTTAATATTACCATTCTGTGGTCCAAATGTAATTGATCACTTTTTCTGTGATTTGCAG
CCCTTGATGAAACTTGCCTGCATGGATACCTATGTGATAAATTTGCTAGTTGTGTCTAAT
AGTGGTGCCATATGCACGATAAGTTTCATAGTGCTTCTTATCTCCTATATTGTAATCTTA
TACTCCCTGAGAAACCACAGTGCAGAAGGAAGACGAAAGGCCTTGTCTACATGTACTTCT
CATTTCATTGTTGTGGTCATATTTTTTGGTCCCTGTATATTTATATATACAAGACCACTA
ATCACTCTACCAATAGATAAAATGTTGTCTGTGTTTTATACAATAGGGACACCTTTGCTC
AATCCTCTTATCTATACTCTGAGGAATGCAGAAGTAAAAAATGCCATGAAAAAAGTATGG
TGTAGTAAAGTA


Conceptual translation

MMHNNSVTEFILLGLTQDSEKQKAIFGVFLILYLMTLLGNFLIVVTIKMSHTLSSPMYFF
LFYLSFADACFSTTTAPRLIVDLLFQKKVITYNECMTQLFAAHFFGCMEIFVLILMAFDR
YVAICKPLRYTIIMNQRICGILVILAWLGSCIHSLAQIFLALILPFCGPNVIDHFFCDLQ
PLMKLACMDTYVINLLVVSNSGAICTISFIVLLISYIVILYSLRNHSAEGRRKALSTCTS
HFIVVVIFFGPCIFIYTRPLITLPIDKMLSVFYTIGTPLLNPLIYTLRNAEVKNAMKKVW
CSKV