Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4d10b Olfactory Receptor

Gene Symbol Or4d10b
Organism Mouse
Family 4
Subfamily d
Pseudo No
Location chr19:12058812-12059813 (-)
Aliases Olfr1424, MOR239-2, MOR239-2

Sequence information


Nucleotide sequence

ATGAAGACAAGGGAAATATCCCGAGGCTTAAAACAAAAAGGCAACGAAAAAAAGGGAGAT
TTAATGGAGATGGAAAACTACACCAGGATCAAAGAACTTATTTTCCTTGGCCTTACCCAA
AGTCAGCAAGTAAGCGCAGTGCTCTTTCTTTTTCTTCTCCTGGTGTATGTGACAACTCTG
CTGGGGAACCTTCTCATCATGGTCACAGTGACCTGTGAGTCTCGCCTTCACACCCCCATG
TATTTCTTGCTCAGGAATTTGTCTGTTGCTGATATCTGCTTTTCCTCCATCACTGCCCCC
AAGGTTCTTGTGGATCTTACCTCAAACAGAAAGACCATCTCTTTCAATGGCTGTCTCACT
CAGATGTTCTTCTTCCACCTTATTGGGGGAGTGGATGCATTTTCTCTGTCTGTGATGGCT
CTAGATCGATACGTGGCCATCTCTAAGCCCTTGCACTATGTGACCATCATGAGCAGAGGC
CGTTGCATTGGGTTAATAGTGGCCTCCTGGGTGGGGGGCTTTGCCCACTCCATAGTGCAG
ATTTCTCTCTTGCTGACACTTCCATTCTGTGGACCCAATGTTCTTGATACTTTCTACTGT
GATGTCCCCCAGGTCATCAAACTTGCTTGCACAGACATTGTTGTTCTTGAGCTGCTGATG
ATTTCCAATAATGGAATGCTCACCACACTATGGTTTTTCTTGTTACTGGTGTCCTACATG
GTCATATTATTATTGCTGAAGTCTCAATCAGGAGAGGGCAAGAAAAAAGCCATCTCCACT
TGCACCACCCACATCACTGTGGTCACCCTGCATTTTGTCCCCTGCATTTATGTCTATGCC
AGACCATTCACTGCCCTCCCCACAGATAAAGTCATCTCTGTCACCTTCACAGTCATCTCC
CCTCTGCTAAACCCCTTGATCTACACTCTGAGGAACCAGGAAATGAAGTCAGCCATGAGG
AGACTCAGGAAAAAATTTCGATTTTCTCATTGGATAGAGAAA


Conceptual translation

MKTREISRGLKQKGNEKKGDLMEMENYTRIKELIFLGLTQSQQVSAVLFLFLLLVYVTTL
LGNLLIMVTVTCESRLHTPMYFLLRNLSVADICFSSITAPKVLVDLTSNRKTISFNGCLT
QMFFFHLIGGVDAFSLSVMALDRYVAISKPLHYVTIMSRGRCIGLIVASWVGGFAHSIVQ
ISLLLTLPFCGPNVLDTFYCDVPQVIKLACTDIVVLELLMISNNGMLTTLWFFLLLVSYM
VILLLLKSQSGEGKKKAISTCTTHITVVTLHFVPCIYVYARPFTALPTDKVISVTFTVIS
PLLNPLIYTLRNQEMKSAMRRLRKKFRFSHWIEK