Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4d10c Olfactory Receptor

Gene Symbol Or4d10c
Organism Mouse
Family 4
Subfamily d
Pseudo No
Location chr19:12087858-12088790 (-)
Aliases Olfr1426, MOR239-1, MOR239-1

Sequence information


Nucleotide sequence

ATGGAAAACTACACCAGGGTGAAAGAACTTATTTTCCTTGGCCTGACCCAAAGTCAAGAA
GTGAGCATGGTGCTCTTTCTTTTCCTTCTCCTGGTGTATGTGACAACTCTGCTGGGGAAC
CTTCTCATCATGGTCACAGTGACCTGTGAGTCTCGCCTTCACACCCCCATGTATTTCTTG
CTCAGGAATTTGTCTGTTGCTGATATCTGCTTTTCCTCCATCACTGCCCCCAAGGTTCTG
GTAGACCTTCTCTCAGACAGAAAGACCATCTCTTTCAATGGCTGTCTCACTCAGATGTTC
TTCTTCCACCTTATTGGGGGAGTGGATGTGTTTTCTCTGTCTGTGATGGCTCTAGATCGA
TATGTGGCCATCTCTAAGCCCTTGCACTATGTGACCATCATGAGCAGAGGGCGTTGCATT
GGGTTAATAGTGGCCTCCTGGGTGGGGGGCTTTGCCCACTCCATAGTGCAGATTTCTCTC
TTGCTGACACTTCCATTCTGTGGACCCAATGTTCTTGATACTTTCTACTGTGATGTCCCC
CAGGTCATCAAACTTGCCTGCACAGACATCTTTGTTCTTGAGCTGCTGATGATTTCCAAT
AATGGCCTGGTTGCTACTCTGTGGTTTGTGTTGTTGGTGGTGTCATACACAGTCATTCTT
ATGATGCTTAGATCTCATTCAGGAGAGGGCAGGAAGAAAGCCATCTCCACCTGCACCTCC
CACATCACTGTGGTCACACTGCACTTTGTGCCCTGCATCTATGTCTATGCCAGGCCCTTC
ACTGCCCTCCCCACGGATAAAGCCATCTCTGTCACCTTCACAGTCATCTCCCCTCTGCTA
AACCCCTTGATCTATACACTGAGGAACCAGGAAATGAAGTCAGCCATGAGGAGACTTAGA
AAAAGACTTGAACCTTTTGATAGAGAAGAGCAA


Conceptual translation

MENYTRVKELIFLGLTQSQEVSMVLFLFLLLVYVTTLLGNLLIMVTVTCESRLHTPMYFL
LRNLSVADICFSSITAPKVLVDLLSDRKTISFNGCLTQMFFFHLIGGVDVFSLSVMALDR
YVAISKPLHYVTIMSRGRCIGLIVASWVGGFAHSIVQISLLLTLPFCGPNVLDTFYCDVP
QVIKLACTDIFVLELLMISNNGLVATLWFVLLVVSYTVILMMLRSHSGEGRKKAISTCTS
HITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMRRLR
KRLEPFDREEQ