Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4d11 Olfactory Receptor

Gene Symbol Or4d11
Organism Rat
Family 4
Subfamily d
Pseudo No
Location chr1:228474343-228475272 (-)
Aliases Olr321, Olr321

Sequence information


Nucleotide sequence

ATGGAGTTGAGAAATAACACCAGAGTAAAAGAATTTATATTTCTGGGTCTAACTCAATCG
CAACACCTGAGCCTGGTCTTATTTCTTGTTTTGTGTTTTGTATACGTGACAACTCTGCTT
GGGAATCTGCTCATCATGATCATCGTGACTTTTGAGTCCCGTCTGCACACGCCCATGTAC
TTCCTGCTCCGAAACCTTGCCATTCTAGACATCTGCTTCTCCTCCATCACAGCACCGAAG
GTCTTGGTGGACCTTCTAACAAAGAAAAAGACCATTTCCTATGCAGAATGCATGACACAG
ATGTTTTTCTTCCATCTGCTTGGTGGGGCAGACATTTTCTCTCTCTCTGTGATGGCATTG
GATAGATACGTGGCCATCTCCAAGCCCCTGCACTATGTGACCATCATGAGTAGTAGGCGG
TGCACAGCCCTCATCGCGGCCTCCTGGGTGGGCGGCTTTGTCCACTCCATCGTGCAGATC
TCCCTCTTGCTCCCACTCCCCTTCTGTGGACCCAATGTTCTTGATACTTTTTATTGCGAT
GTCCCACAGGTTCTCAAACTCGCTTGCACAGACACCTTTGTTCTCGAGCTCCTGATGATC
TCAAACAACGGCCTGGTCACTACCCTCTGGTTTATCTTCCTGCTGGTGTCCTACATGGTC
ATCTTGACGATGTTGAGGTCTCAGGCAGGAGAGGACAGGAGAAAAGCCATCTCCACATGC
ACCGCCCACATCACTGTGGTCACCCTGCATTTTGTACCCTGCATCTATGTCTACGCCAGG
CCCTTCACTGCCCTCCCTACAGATAAAGCCATCTCTGTTACCTTCACAGTCATCTCCCCT
CTATTGAACCCATTGATCTACACTCTGAGGAACCAGGAAATGAAGTCAGCCATGAAGAGG
CTAAAGAGAAAGCTCACACCTCTTGAAAAG


Conceptual translation

MELRNNTRVKEFIFLGLTQSQHLSLVLFLVLCFVYVTTLLGNLLIMIIVTFESRLHTPMY
FLLRNLAILDICFSSITAPKVLVDLLTKKKTISYAECMTQMFFFHLLGGADIFSLSVMAL
DRYVAISKPLHYVTIMSSRRCTALIAASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLACTDTFVLELLMISNNGLVTTLWFIFLLVSYMVILTMLRSQAGEDRRKAISTC
TAHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAMKR
LKRKLTPLEK