Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4e5 Olfactory Receptor

Gene Symbol Or4e5
Organism Rat
Family 4
Subfamily e
Pseudo No
Location chr15:28934268-28935269 (-)
Aliases Olr1645

Sequence information


Nucleotide sequence

ATGGAAAAGGCTGTCCTCATCAACCAAACTTCAGTGACATCATTTCGGCTCACAGGTTTA
TCTGCAAATCCAAAAGTACAGATGTTTGTGTTTTTCATATTCCTCGTTTTCTATGTCATG
ACACTGGTTGGTAACATCCTCATTGTCATAACAATCATATTCGACCACCGCCTCCATACT
CCCATGTATTTCTTCCTCAGCAATCTATCCTTTATTGATGTCTGCCATTCCACTGTTACT
GTCCCAAAGATGCTGAGTGACACTTTGTCAGATGAAAAGGTCATCTCTTTTGATGCCTGT
GTGGTCCAGATATTTTTCCTGCATCTCTTTGCCTGCACGGAGATCTTCCTGCTTACTGTC
ATGGCCTATGACCGCTATGTGGCCATTTGTAAGCCTTTGAGGTATATGACAATAATGAAC
TGGAAGGTGTGTACGGTGCTGGGAGTGGCCATGTGGACAGCAGGGACTGTGCACTCCATA
TCTTTCACCTCACTCACCATCAAGCTGCCCTACTGTGGTCCTGATGAGATTGACAACTTC
TTCTGTGATGTACCTCAAGTGATAGAACTGGCTTGCACTGACACCCGCATCACTGAGATT
CTCGTTGTCTCCAACAGTGGGATGATCTCTATGGTATGTTTTGTGATTATTGTTGTTTCC
TATGCAGTCATTCTTGTGAGTCTGAGGCAACAGATCTCTGACGGCAAGAGGAAAGCCCTG
TCCACCTGTGCAGCCCACCTCACTGTGGTCACTCTGTTTCTGGGACACTGTATCTTCATC
TACTCACGCCCATCCATCAGCCTTCCCGAGGACAAAATTGTATCTGCATTTTTCACTGCT
GTAACCCCTCTGTTGAATCCCATAATCTACACCTTTAGGAATGAGGACATGAAGAGTGCC
TTGAAGAAGTTAATCAGGAGGAAAGAGAGGAAAGAAAGTAAAAATGATAACTGCTTAGGA
TTCTTAGTGATCCAAATCAAAGAATCAACTATATATTGTATT


Conceptual translation

MEKAVLINQTSVTSFRLTGLSANPKVQMFVFFIFLVFYVMTLVGNILIVITIIFDHRLHT
PMYFFLSNLSFIDVCHSTVTVPKMLSDTLSDEKVISFDACVVQIFFLHLFACTEIFLLTV
MAYDRYVAICKPLRYMTIMNWKVCTVLGVAMWTAGTVHSISFTSLTIKLPYCGPDEIDNF
FCDVPQVIELACTDTRITEILVVSNSGMISMVCFVIIVVSYAVILVSLRQQISDGKRKAL
STCAAHLTVVTLFLGHCIFIYSRPSISLPEDKIVSAFFTAVTPLLNPIIYTFRNEDMKSA
LKKLIRRKERKESKNDNCLGFLVIQIKESTIYCI