Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f47 Olfactory Receptor

Gene Symbol Or4f47
Organism Rat
Family 4
Subfamily f
Pseudo No
Location chr3:103,557,000-103,558,000 (+)
Aliases Olr792

Sequence information


Nucleotide sequence

ATGGATGGAGGAAATCACTCAGTGGTATCAGAATTTTTGTTGCTAGGCCTCACCAATTCA
TGGAGAATTCAGATTCTCCTTTTTCTGTTCTTCACAGTATTTTATGTAGCAAGCATGCTG
GGAAATCTGCTCATTGTGCTCACAATCATCTCAGACCATCACCTGCACTCCCCCATGTAC
TTCCTGCTGGCAAACCTCTCCTTCATTGATACAGGTGTGTCCAGCATTGCTACTCCAAAG
ATGATTTCTGACCTCTTCAGAAAGCACAAAGCCATCTCCTTGAACGGGTGCATCACTCAG
ATGTTCTTCATTCACACTGTTGGGGGAACAGAGATGGTGTTGCTCATAGTCATGGCCTAT
GACAGGTACACTGCTATCTGTAAGCCCCTCCACTACCTCACCATCATGAGTCTCAGAATG
TGCATTGTTCTTGTGGCTCTTGCTTGGACCATTGGCCTGATCCATTCTGTGGCCCAGCTG
GCTTTTGTTGTAAGTTTACCCTTCTGTGGAGCTAATAAAATGGACAGCTTTTATTGTGAT
TTTCCTCGGTTCATCAAGCTTGCATGTACAGATACATACAGACTGGAGTTCCTGGTCACT
GCCAACAGTGGTTTCATCTCCATGGCCACTTTCTTCATCCTGATTGTGTCTTACCTCTTC
ATCCTGGTCACGGTTCATAAACACTCCTCAGGTGCTTCCTCCAAGGCCCTCTCCACTCTC
TCGGCTCACATCACTGTGGTGATTTTGTTCTTTGGTCCTTGCATTATTGTCTATGTGTGG
CCTTTCCCTACTTTACCCATAGATAAATTTTTGGCGATTTTTGATGCCATTATCACTCCT
TCTATGAATCCTGTCATCTACACGCTGAGAAATAATGAGATGAAGGTTGCAATAAGGAAA
CTCTTTGTTAGAGCTTTAAGTATCATTGGCAGTTTAAGAGCTTCAGAT


Conceptual translation

MDGGNHSVVSEFLLLGLTNSWRIQILLFLFFTVFYVASMLGNLLIVLTIISDHHLHSPMY
FLLANLSFIDTGVSSIATPKMISDLFRKHKAISLNGCITQMFFIHTVGGTEMVLLIVMAY
DRYTAICKPLHYLTIMSLRMCIVLVALAWTIGLIHSVAQLAFVVSLPFCGANKMDSFYCD
FPRFIKLACTDTYRLEFLVTANSGFISMATFFILIVSYLFILVTVHKHSSGASSKALSTL
SAHITVVILFFGPCIIVYVWPFPTLPIDKFLAIFDAIITPSMNPVIYTLRNNEMKVAIRK
LFVRALSIIGSLRASD