Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4f47 Olfactory Receptor

Gene Symbol Or4f47
Organism Mouse
Family 4
Subfamily f
Pseudo No
Location chr2:112141947-112142894 (+)
Aliases Olfr1317, RP23-63C10.1, MOR245-4

Sequence information


Nucleotide sequence

ATGGATGGAGGAAATCACTCAGTGGTATCAGAATTTTTGTTACTAGGCCTCACCAATTCA
TGGAGAATTCAGATTCTCCTTTTTCTGTTCTTCACAGTATTTTATGTGGCAAGTATGCTG
GGGAACCTGCTCATTGTGCTCACAATCATCTCAGACCACCACCTGCACTCCCCCATGTAC
TTCCTGCTGGCAAACCTCTCCTTCATTGATACAGGTGTGTCCAGCATCGCTACTCCAAAG
ATGATTTATGACCTCTTCAGGAAGCACAAAGTCATCTCCTTGAACGGATGCATCACTCAG
ATGTTCTTCATCCACACTGTTGGGGGAACAGAGATGGTGTTGCTCATAGTCATGGCCTAT
GACAGGTACATTGCTATCTGTAAGCCCCTCCACTACCTGACCATCATGAGTCTCAGAATG
TGCATTGTTCTTTTGGCTCTTGCTTGGATCATTGGCCTTATCCATTCTGTGGCCCAATTG
GCTTTTGTTGTAAATTTACCCTTTTGTGGAGCTAATAAAATGGACAGCTTTTACTGTGAT
TTTCCTCGGTTCATCAAACTCGCATGTACAGACACATACAGACTGGAGTTCCTGGTCACT
GCCAACAGTGGTTTCATCTCCATGGCCACCTTCTTCATCCTGATTGTGTCTTACATCTTC
ATCCTGGTCACAGTTCGTAAACACTCCTCAGGTGCTTCCTCCAAGGCCCTCTCCACTCTC
TCAGCTCACATCACTGTGGTCGTTTTCTTCTTTGGTCCTTGCATTATTGTCTATGTGTGG
CCTTTCCCGACTTTACCCATAGATAAATTTTTAGCAATTTTCGATGCCATTATCACTCCT
TCTATGAATCCTGTCATCTATACACTGAGAAATAAGGAAATGAAGGTTGCAATGAGGAGA
CTCTTTGCTAGGGCTTTAAGTTTCATTGACAGCTTAAGAGATTCAAAT


Conceptual translation

MDGGNHSVVSEFLLLGLTNSWRIQILLFLFFTVFYVASMLGNLLIVLTIISDHHLHSPMY
FLLANLSFIDTGVSSIATPKMIYDLFRKHKVISLNGCITQMFFIHTVGGTEMVLLIVMAY
DRYIAICKPLHYLTIMSLRMCIVLLALAWIIGLIHSVAQLAFVVNLPFCGANKMDSFYCD
FPRFIKLACTDTYRLEFLVTANSGFISMATFFILIVSYIFILVTVRKHSSGASSKALSTL
SAHITVVVFFFGPCIIVYVWPFPTLPIDKFLAIFDAIITPSMNPVIYTLRNKEMKVAMRR
LFARALSFIDSLRDSN