Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f58c-ps Olfactory Receptor

Gene Symbol Or4f58c-ps
Organism Rat
Family 4
Subfamily f
Pseudo Yes
Location chr3:103616218-103616592 (+)
Aliases Olr794-ps

Sequence information


Nucleotide sequence

ATGCCCCGCCAGGGCTGCTTTCCCCACCCCCACCAACCCCACCCCCAGCAGCAAGAAGCC
ACCTCATTCTGAGGTTGTATAACTCAGATCTCCTTTATTCATGCTATTGGGGGCACAGAA
AGGGTGCTTCTCATAGCCATGGCCTTTGACAAGTATGTAGCCATATGTAAACCTCTTCAG
TACTTGCCCATCATGAGACCACAAATATGCATTTTAATTTTGGCAGTATCCTGGATCCTT
GGACTTATTCACTCAGTGACGCAACTAGCTTTTGTTGTAGACTTGCCTTTCTGTGGACCT
AATATATTGGACAGCTTTTACTGTGATCTCCCTCAGCTTTTTAAAATTGCTTGCAGAGAC
CAATTTACTGGAGTT


Conceptual translation

MPRQGCFPHPHQPHPQQQEATSF*GCITQISFIHAIGGTERVLLIAMAFDKYVAICKPLQ
YLPIMRPQICILILAVSWILGLIHSVTQLAFVVDLPFCGPNILDSFYCDLPQLFKIACRD
QFTGV\VTANSGLISVGSFFILIISYIFILVTVRKHSSGGISKALSTWSAHVTVVVLFF
GPLIFFYT*PFPSSHLDKFLAIFEAVLTPSLNPVIYTI\NKEMKAAMRKLCSQVVNYRK
A