Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f59 Olfactory Receptor

Gene Symbol Or4f59
Organism Rat
Family 4
Subfamily f
Pseudo No
Location chr3:103223665-103224624 (-)
Aliases Olr785

Sequence information


Nucleotide sequence

ATGGGAAGTGTGAATCAGTCTGTGGTGTCAGAGTTTGTGTTCCTGGGACTCACCAATTCT
TGGGATATCCAACTATTCCTTTTTGTGTTCTCCTCCATATTTTATGTGGCAAGCATGATG
GGAAACTCTCTCATTGTCTTCACTGTGGCATCTGACCCTCACTTACACTCTCCTATGTAC
TTTCTGTTGGCTAACCTCTCTTTCATTGACTTGGGTATTTCTTCTGTTACTTCCCCGAAG
ATGATTTGTGACCTATTCAGAAAGCATAAAGTCATCTCTTTTAGAGGTTGTGTTACTCAA
ATCTTCTTCATCCATGTTATTGGTGGTGTGGAAATGGTTTTACTCATAGCCATGGCCTTT
GACAGATATGTGGCCATATGTAAGCCTCTCCATTACCTGACCATCATGAGCCCAAGGATG
TGCATCTTGTTTTCAGTGGCTGCCTGGGTGGTTGGCCTTATGCATTCTCTGGTTCAACTG
GTTTTTGTAGTAAACTTACCATTCTGTGGACCAAATGTGTTGGACAGCTTCTACTGTGAC
TTTCCCCGGTTCATCAAACTTGCTTGCACAGATACATACAAACTGGAATTACTGGTCTCA
ATCAATAGTGGATTCATGTCTGTGGGCTCTTTCTTCATACTGATCATTTCCTATATTGTC
ATCATATTTACTGTTCAGAAACACTCTTCAAGTGGTTCTTCCAAGGCTCTATCTACACTT
TCAGCTCATGTTACTGTAGTGGTTTTATTCTTTGGTCCTGTGATATTTTTCTATACATGG
CCGTCTTCTTATACACACCTAGATAAATTTCTGGCTATATTTGATGCAATTGTCACTCCT
TTTCTGAACCCAGTGATCTATACATTGAGGAACCAAGAAATGAAAATGGCAATGATGAGA
GTATTCAGCAAGCTAATAGGTTATAGCCAAATTCTTAAACATTTGAACTTTGAACAGCCT


Conceptual translation

MGSVNQSVVSEFVFLGLTNSWDIQLFLFVFSSIFYVASMMGNSLIVFTVASDPHLHSPMY
FLLANLSFIDLGISSVTSPKMICDLFRKHKVISFRGCVTQIFFIHVIGGVEMVLLIAMAF
DRYVAICKPLHYLTIMSPRMCILFSVAAWVVGLMHSLVQLVFVVNLPFCGPNVLDSFYCD
FPRFIKLACTDTYKLELLVSINSGFMSVGSFFILIISYIVIIFTVQKHSSSGSSKALSTL
SAHVTVVVLFFGPVIFFYTWPSSYTHLDKFLAIFDAIVTPFLNPVIYTLRNQEMKMAMMR
VFSKLIGYSQILKHLNFEQP