Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f60 Olfactory Receptor

Gene Symbol Or4f60
Organism Rat
Family 4
Subfamily f
Pseudo No
Location chr3:103657115-103658047 (+)
Aliases Olr796

Sequence information


Nucleotide sequence

ATGAAGAGAGTGAATCATTCTGTGACATCAGAGTTTGTGTTCCTGGGACTCACAAACTCC
TGGGATATTCAACTGCTTCTCTTTCTGGTATCCTCAATGTTGTATGTGACAAACATGATG
GGAAACTGTCTAATAATTTTCACTGTGGCTTCAGACCCTCACTTACATTCCCCTATGTAC
TTTCTTCTGGCTAACCTCTCCTTCATTGACCTAGGTGTTTCTTCTGCCACTTCCCCCAAG
ATGATTTCTGACTTATTAAAAAAGCACAAAGTCATCTCCTTTAGAGGCTGTATTACTCAA
ATCTTCTTCATCCATGCAATTGGTGGTGCAGAGATGGTGCTGCTCATAGCCATGGCCTTT
GATAGATATGTGGCCATATGTAAGCCTCTTCATTATCTGACCATGATGAGCCCCCAGATG
TGCATCTTCTTTTTAATTACTGCCTGGGTAGTTGGTCTTATGCACTCTGTAATACAACTG
GTTTTCATAGTTAATTTACCTCTCTGTGGTCCTAATATATTGGATAGCTTCTACTGTGAC
CTTCCTCAATTTATCAAACTTGCTTGCATGAACACACATAGACTGGAATTACTGGTCTCA
ATCAGTAGTGGATTCATGTCTTTGGGTTCTTTCTTCCTACTGAGCATTTCCTATATTGTC
ATCATACTTACTGTTCTGAAACACTCTTCAAATGGTGCCTACAAAGCTCTTTCTACACTT
TCAGCTCATGTGAGCGTAGTGGTTTTATTCTTTGGTCCTGCCATATTTTTCTATATATGG
CCTTCTTCTACACACCTGGATAAATTTCTGGCCCTATTTGATGCAGTTGTTACTCCTTTT
TTGAACCCTGTGATCTACACATTGAGGAATAAAGAAATGAAGATGGCAATGAGGAGAGTA
TTCCGACATCTAATGGGCTATAGACAAATCTCT


Conceptual translation

MKRVNHSVTSEFVFLGLTNSWDIQLLLFLVSSMLYVTNMMGNCLIIFTVASDPHLHSPMY
FLLANLSFIDLGVSSATSPKMISDLLKKHKVISFRGCITQIFFIHAIGGAEMVLLIAMAF
DRYVAICKPLHYLTMMSPQMCIFFLITAWVVGLMHSVIQLVFIVNLPLCGPNILDSFYCD
LPQFIKLACMNTHRLELLVSISSGFMSLGSFFLLSISYIVIILTVLKHSSNGAYKALSTL
SAHVSVVVLFFGPAIFFYIWPSSTHLDKFLALFDAVVTPFLNPVIYTLRNKEMKMAMRRV
FRHLMGYRQIS