Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f60b Olfactory Receptor

Gene Symbol Or4f60b
Organism Rat
Family 4
Subfamily f
Pseudo No
Location chr3:103248396-103249328 (+)
Aliases Olr786

Sequence information


Nucleotide sequence

ATGAAGAAAGTGAATTATTCTGTGACATCAGAGTTTGTGTTCCTGGGATTCACAAACTCC
TGGGATATCCAACTGCTGCTCTTTCTGGTATCCTCAATGTTCTATGTGGCATGCATAATG
GGAAACTGTCTAATAATTTTCACTGTGGCCTCAGATACTCACTTACATTCCCCTATGTAC
TTTCTTCTGGCTAACCTCTCCTTCATTGATGTAGGTATTTCTTCTGCCACTTCTCCCAAG
ATGATTTCTGACTTATTAAAAAAGCACAAAGTCATCTCCTTTAGAGGCTGTGTTATTCAA
ATCTTCTTCAACCAGGCAATTGGCGGTGCCGAGATGGTGCTGCTCATAGCCATGGCCTTT
GATAGATATGTGGCCATATGTAAGCCTCTTCATTATCTGACCATGATGAGCCCCCAGATG
TGCCTCTTCTTTTTAATTACTGCCTGGGTAGTTGGTCTTATGCACTCTGTGATACAACTG
ATTTTCATAGTAAATTTACCTCTCTGTGGTCCTAATATATTGGACAGCTTCTTCTGTGAT
CTTCCTCAATTTATCAAACTTGCTTGCATGAACACATATAGACTGGAATTACTGGTCTCA
ATCAGTAGTGGATTCATGTCTTTGGTTTCTTTCTTCCTACTGAGCATTTCCTATATTGTC
ATCATACTTACTGTTCTGAAACACTCTTCAAGTGGTGCCTACAAAGCTCTTTCTACACTT
TCAGCTCATGTGACCGTAGTGGTTTTATTCTTCGGTCCTGCCATATTTTTCTATATATGG
CCTTCTTCTACACACCTGGATAAATTTCTGGTCCTATTTGATGCAGTTGTTACTCCTTTT
TTGAACCCTGTGATCTACACATTGAGGAATAAAGAAATGAAGAGGGCAATGAGGAGAGTA
TTCCGACATCTAATGGGCTATAGACAAATCTCT


Conceptual translation

MKKVNYSVTSEFVFLGFTNSWDIQLLLFLVSSMFYVACIMGNCLIIFTVASDTHLHSPMY
FLLANLSFIDVGISSATSPKMISDLLKKHKVISFRGCVIQIFFNQAIGGAEMVLLIAMAF
DRYVAICKPLHYLTMMSPQMCLFFLITAWVVGLMHSVIQLIFIVNLPLCGPNILDSFFCD
LPQFIKLACMNTYRLELLVSISSGFMSLVSFFLLSISYIVIILTVLKHSSSGAYKALSTL
SAHVTVVVLFFGPAIFFYIWPSSTHLDKFLVLFDAVVTPFLNPVIYTLRNKEMKRAMRRV
FRHLMGYRQIS