Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4f6b Olfactory Receptor

Gene Symbol Or4f6b
Organism Rat
Family 4
Subfamily f
Pseudo No
Location chr3:103637469-103638404 (+)
Aliases Olr795

Sequence information


Nucleotide sequence

ATGGGTAAAACAAACCGCTCTTTGGTGTCTGAGTTTGTGTTCCTGGGACTCTCCAACTCA
TGGATGATCCAGCTATTCCTTTTCCTCTTTTCCTGTGTGTTCTACATGGCAAGTCTGTTG
GGAAATTTTCTCATTGTGCTAACCGTAACTTCAAACCCCCAATTACATTCCCCTATGTAC
TTCCTCTTAGCCAATCTTTCCATCATTGACTTGATATGTTCCTCATTCACAGCACCCAAG
ATGATTTTTGACCTTCTGAGAAAGCACAAAACCATCTCTTTTGGTGGTTGCATCACTCAG
ATCTTTTTTATCCATGCAGTAGGTGGCACTGAGATGCTGCTGCTTATAGCCATGGCGTTT
GATCGATATGTTGCCATATGTAAGCCTCTGCATTACCTGATCATCATGAGCCCACAAAAC
TGCATTTTGATTTTGGTTGCTTCTTGGATTATTGGCTTCATTCATTCAGTGACTCAGTTG
ATTTTTGTGGTAGACTTGCCCTTCTGTGGCCCTAATGAATTAGACAGCTTTTTCTGTGAC
CTACCTCGGTTTATTAAACTTGCCTGTATAAACACCAACACATTGGAGTTTATGGTTACT
GCCAATAGTGGGTTCATTTCTGTGGTCTCCTTTTTAATTCTGATCATCTCTTACATATTT
ATTTTGGTGACTGTTCAAAAGAAATCTTTGGGTAGTTTATATAAGGCCCTCTCCACCCTG
TCAGCTCATGTCATGGTGGTAGTTTTGTTCTTTGGACCCTTAATCTTCTTCTACTTGTGG
CCATTTCCAACATCACATCTGGATAAATTTCTTGCCATCTTCGATGTAATTGTTACTCCT
TTTCTAAATCCAGTTATATACACACTTAGGAATAAAGAGATGAAGGTGGCGATGAAAAGA
CTATGCACTCGGTTTATGAATTATATTAAGCTTTCT


Conceptual translation

MGKTNRSLVSEFVFLGLSNSWMIQLFLFLFSCVFYMASLLGNFLIVLTVTSNPQLHSPMY
FLLANLSIIDLICSSFTAPKMIFDLLRKHKTISFGGCITQIFFIHAVGGTEMLLLIAMAF
DRYVAICKPLHYLIIMSPQNCILILVASWIIGFIHSVTQLIFVVDLPFCGPNELDSFFCD
LPRFIKLACINTNTLEFMVTANSGFISVVSFLILIISYIFILVTVQKKSLGSLYKALSTL
SAHVMVVVLFFGPLIFFYLWPFPTSHLDKFLAIFDVIVTPFLNPVIYTLRNKEMKVAMKR
LCTRFMNYIKLS