Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4g16 Olfactory Receptor

Gene Symbol Or4g16
Organism Rat
Family 4
Subfamily g
Pseudo No
Location chr3:102529178-102530113 (+)
Aliases Olr752

Sequence information


Nucleotide sequence

ATGCCAATGGATCAACTAAATGCCTCCAGAGTTTCTGAGTTTGTTCTTCTAGGACTCTCT
AGTTCTTGGGAAATGAAAGTTTTTCTCATGGTAACATTCTCAATGCTCTACATCGGAATC
ATTTTGGGAAATCTCTTCATTGTCATTTTAGTAATTGCTGACTCTCACTTGCATTCACCC
ATGTACTTCCTGTTGGCCAACCTGTCTTTGAATGATGTGTGGGTCTCCTCCACCACAGTT
CCCAAGATGATCTCAGATCTTCTGAAAGAACACAAAGTCATTTCTTTCCACAATTGCATG
TCTCAGATCTGCTTTATCCACATTATGGGAGGAGTGGAGATGGTGCTGCTCATAGCCATG
GCGTTTGACAGGTACATAGCCATCTGTAAGCCTCTGCGCTATTTGAGCATCATGAGCCCT
AGAATATGCATTTCATTTGTAATTGCTGGCTGGGTCACTGGAGTGATTCATGCCCTGTCA
CAGTTCTCTTTTGTTGTAAACCTGCCTTTTTGTGGTCCTAACAAAGTGGACAGCTTTTAC
TGTGACTTCCCTCGAATCATACAACTCGCCTGCACAGATGGAGACAAGTTTGAGTTTGTT
GTTGCTGCCAACAGTGGCTTCATGAGCATGGGGACCTTCTTCTTGCTTCTCCTCTCCTAT
GTCTTCATTTTGGTCACAGTCTGGCAAAGGTCTTCAGGGGACTTGTCAAAGGCTCTTGTC
ACTCTGTCAGCTCACATCACTGTGGTCGTTCTGTTTTTTACTCCATGCATGTTTCTCTAT
GTGTGGCCTTTCCCCACATCATCGATTGACAAATATCTGTTTATTGCTGACTTTGCTATC
ACACCTGCCCTGAATCCTGTCATTTATACATTAAGAAACAAAGATATAAGAATATCAATT
CAAAGATTATGCAAAAGAGCTAATTGTAGCAGATTT


Conceptual translation

MPMDQLNASRVSEFVLLGLSSSWEMKVFLMVTFSMLYIGIILGNLFIVILVIADSHLHSP
MYFLLANLSLNDVWVSSTTVPKMISDLLKEHKVISFHNCMSQICFIHIMGGVEMVLLIAM
AFDRYIAICKPLRYLSIMSPRICISFVIAGWVTGVIHALSQFSFVVNLPFCGPNKVDSFY
CDFPRIIQLACTDGDKFEFVVAANSGFMSMGTFFLLLLSYVFILVTVWQRSSGDLSKALV
TLSAHITVVVLFFTPCMFLYVWPFPTSSIDKYLFIADFAITPALNPVIYTLRNKDIRISI
QRLCKRANCSRF