Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4j1-ps Olfactory Receptor

Gene Symbol Or4j1-ps
Organism Rat
Family 4
Subfamily j
Pseudo Yes
Location chr3:76,959,300-76,960,200 (-)
Aliases Olr642-ps

Sequence information


Conceptual translation

MSLVHVPVFHVITPMLIVDPLF*EDYLIFF*KYMTHLFEM\FAGMEVIIFFVIAYDYSV
GICNPLYYKTIIMCPQMCCMLLWGA*EGGCMH*NIQPL/FALNFFGHNVIDHIL*YLFQ
LLMLSCMDIHSPFLIVIFNNDIIFDHFLCSCASYMAILCSLKTH/PEGRLNLLSTHGSY
ITVVVLF/LLYIFLLVRPVTTYSIDKAVIESKSVIPDALKPFIYTLRNAEVKYAVKKH