Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or4k15c Olfactory Receptor

Gene Symbol Or4k15c
Organism Rat
Family 4
Subfamily k
Pseudo No
Location chr15:26855273-26856241 (-)
Aliases Olr1626

Sequence information


Nucleotide sequence

ATGAATGAAACAAATTACACTCGGGTGTCAGAGTTTGTGCTGTTGGGCCTGTCTAGTTCA
AAGGAGCTCCAGCCTTTCCTGTTTCTCATATTTTCACTGCTGTATCTTGCAATACTGCTG
GGTAACTTCCTCATCATCCTCACAGTGACTTCAGACTCACGACTTCACACTCCCATGTAC
TTTCTGCTTGCAAACCTATCTTTTATAGATATATGTGTATCCTCATTTGCTACCCCCAAA
ATGCTTGCTGACTTTCTGGTGGAAAGAAAAACTATATCTTTTGAAGCCTGTATGGCTCAG
ATTTTCTGTGTCCATCAATTTGCTGGTGGGGAGATGGTCCTTCTTGTATCCATGGCCTAT
GATCGCTATGTGGCAATATGCAAGCCCCTCCATTATATGACGATCATGAGTCGCCGTGTG
TGTATCATTCTGGTCATTATCCCTTGGTTTGTAGGTTTTATCCATACAATGAGTCAGTTG
GCGTTCACTGTTAACTTGCCATTTTGTGGTCCTAACCAGGTGGACAGTTTTTTCTGTGAT
CTCCCACTGGTGACCAAGCTAGCTTGCACAGACACTTATGTTATCAGTTTGCTAATAGTT
GCAGATAGTGGAGTTCTCACAATGTGTACATTTGTCTTCTTGGTCGTCTCCTACACTGTG
ATTCTCATTACTGTTAGGAATCGTTCCTCTGCTAGCATGGCCAAGGCCCGATCCACCCTA
ACCGCTCACATCACTGTAGTCATACTATTCTTTGGACCATGCATCTTCATCTATGTGTGG
CCCTTTAATGGCTATTCACTTGACAAAGTCCTTGCTGTGTTCTACACCATCTTCACACCC
ATTTTAAACCCACTTATCTACACTCTGAGGAACAAAGATGTGAAAGCAGCTATGTCAAAG
CTGAGGAGTCGCTATCTGAAACCTGGACAGGTTTCTTCATTGATAAGAAATGTTCTTTTT
CCGGAAACA


Conceptual translation

MNETNYTRVSEFVLLGLSSSKELQPFLFLIFSLLYLAILLGNFLIILTVTSDSRLHTPMY
FLLANLSFIDICVSSFATPKMLADFLVERKTISFEACMAQIFCVHQFAGGEMVLLVSMAY
DRYVAICKPLHYMTIMSRRVCIILVIIPWFVGFIHTMSQLAFTVNLPFCGPNQVDSFFCD
LPLVTKLACTDTYVISLLIVADSGVLTMCTFVFLVVSYTVILITVRNRSSASMAKARSTL
TAHITVVILFFGPCIFIYVWPFNGYSLDKVLAVFYTIFTPILNPLIYTLRNKDVKAAMSK
LRSRYLKPGQVSSLIRNVLFPET